BLASTX nr result
ID: Cornus23_contig00045779
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00045779 (297 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003842999.1| hypothetical protein LEMA_P087590.1 [Leptosp... 81 4e-13 ref|XP_009652396.1| endoglucanase-1 [Verticillium dahliae VdLs.1... 74 6e-11 ref|XP_001940574.1| endoglucanase A precursor [Pyrenophora triti... 74 6e-11 emb|CRK45335.1| hypothetical protein BN1723_006562, partial [Ver... 72 2e-10 emb|CRJ80758.1| hypothetical protein BN1708_000366, partial [Ver... 72 2e-10 emb|CRK06911.1| hypothetical protein BN1708_009744, partial [Ver... 72 2e-10 ref|XP_003006971.1| endoglucanase-1 [Verticillium alfalfae VaMs.... 72 2e-10 ref|XP_007697688.1| glycoside hydrolase family 12 protein [Bipol... 70 5e-10 ref|XP_007706495.1| glycoside hydrolase family 12 protein [Bipol... 70 8e-10 gb|ENH87033.1| endoglucanase a precursor [Colletotrichum orbicul... 70 8e-10 ref|XP_014075771.1| glycoside hydrolase family 12 protein [Bipol... 70 8e-10 emb|CCF44295.1| xyloglucan-specific endo-beta-1,4-glucanase A [C... 69 1e-09 ref|XP_001792584.1| hypothetical protein SNOG_01962 [Parastagono... 69 1e-09 gb|EQB54057.1| glycosyl hydrolase family 12 [Colletotrichum gloe... 69 2e-09 ref|XP_007285310.1| xyloglucan-specific endo-beta-glucanase prec... 69 2e-09 ref|XP_007683939.1| glycoside hydrolase family 12 protein [Bipol... 68 2e-09 ref|XP_007597054.1| xyloglucan-specific endo-beta-1,4-glucanase ... 66 1e-08 emb|CCF33542.1| endoglucanase-1 [Colletotrichum higginsianum] 65 2e-08 ref|XP_008098797.1| glycosyl hydrolase family 12 [Colletotrichum... 65 2e-08 gb|KDN65886.1| putative glycosyl hydrolase family 12 [Colletotri... 65 2e-08 >ref|XP_003842999.1| hypothetical protein LEMA_P087590.1 [Leptosphaeria maculans JN3] gi|312219577|emb|CBX99520.1| hypothetical protein LEMA_P087590.1 [Leptosphaeria maculans JN3] Length = 741 Score = 80.9 bits (198), Expect = 4e-13 Identities = 39/48 (81%), Positives = 43/48 (89%) Frame = -3 Query: 295 DLMVFVNYLTSKQGMPKTQILQSVGAGTEPFSGNNAVFTTSAYSLTQT 152 DLM FVNYLTS+QGM ++QILQS GAGTEPFSGNNA FTTSAYSL+ T Sbjct: 694 DLMEFVNYLTSQQGMSRSQILQSAGAGTEPFSGNNAKFTTSAYSLSHT 741 >ref|XP_009652396.1| endoglucanase-1 [Verticillium dahliae VdLs.17] gi|346979127|gb|EGY22579.1| endoglucanase-1 [Verticillium dahliae VdLs.17] Length = 246 Score = 73.6 bits (179), Expect = 6e-11 Identities = 33/46 (71%), Positives = 40/46 (86%) Frame = -3 Query: 295 DLMVFVNYLTSKQGMPKTQILQSVGAGTEPFSGNNAVFTTSAYSLT 158 DL FVNYL + G+PKTQILQSVGAGTEPF+G+NAVFTTS+Y ++ Sbjct: 199 DLYAFVNYLAANHGLPKTQILQSVGAGTEPFTGSNAVFTTSSYQVS 244 >ref|XP_001940574.1| endoglucanase A precursor [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187976667|gb|EDU43293.1| endoglucanase A precursor [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 245 Score = 73.6 bits (179), Expect = 6e-11 Identities = 35/48 (72%), Positives = 39/48 (81%) Frame = -3 Query: 295 DLMVFVNYLTSKQGMPKTQILQSVGAGTEPFSGNNAVFTTSAYSLTQT 152 DLM F+ YLTSKQGMP TQ L S GAGTEPFSG+NA TT+AYSLT + Sbjct: 198 DLMEFMKYLTSKQGMPSTQFLTSTGAGTEPFSGSNAKLTTTAYSLTMS 245 >emb|CRK45335.1| hypothetical protein BN1723_006562, partial [Verticillium longisporum] Length = 104 Score = 72.0 bits (175), Expect = 2e-10 Identities = 32/46 (69%), Positives = 40/46 (86%) Frame = -3 Query: 295 DLMVFVNYLTSKQGMPKTQILQSVGAGTEPFSGNNAVFTTSAYSLT 158 DL FVNYL + G+PK+QILQSVGAGTEPF+G+NAVFTTS+Y ++ Sbjct: 57 DLYAFVNYLAANHGLPKSQILQSVGAGTEPFTGSNAVFTTSSYQVS 102 >emb|CRJ80758.1| hypothetical protein BN1708_000366, partial [Verticillium longisporum] gi|913814804|emb|CRK45332.1| hypothetical protein BN1723_006559, partial [Verticillium longisporum] Length = 241 Score = 72.0 bits (175), Expect = 2e-10 Identities = 31/46 (67%), Positives = 41/46 (89%) Frame = -3 Query: 295 DLMVFVNYLTSKQGMPKTQILQSVGAGTEPFSGNNAVFTTSAYSLT 158 DL FVNYL++ G+PK+Q+LQSVGAGTEPF+G+NAVFTTS+Y ++ Sbjct: 194 DLYAFVNYLSANHGLPKSQVLQSVGAGTEPFTGSNAVFTTSSYQVS 239 >emb|CRK06911.1| hypothetical protein BN1708_009744, partial [Verticillium longisporum] Length = 242 Score = 72.0 bits (175), Expect = 2e-10 Identities = 32/46 (69%), Positives = 40/46 (86%) Frame = -3 Query: 295 DLMVFVNYLTSKQGMPKTQILQSVGAGTEPFSGNNAVFTTSAYSLT 158 DL FVNYL + G+PK+QILQSVGAGTEPF+G+NAVFTTS+Y ++ Sbjct: 195 DLYAFVNYLAANHGLPKSQILQSVGAGTEPFTGSNAVFTTSSYQVS 240 >ref|XP_003006971.1| endoglucanase-1 [Verticillium alfalfae VaMs.102] gi|261354573|gb|EEY17001.1| endoglucanase-1 [Verticillium alfalfae VaMs.102] Length = 242 Score = 72.0 bits (175), Expect = 2e-10 Identities = 32/46 (69%), Positives = 40/46 (86%) Frame = -3 Query: 295 DLMVFVNYLTSKQGMPKTQILQSVGAGTEPFSGNNAVFTTSAYSLT 158 DL FVNYL + G+PK+QILQSVGAGTEPF+G+NAVFTTS+Y ++ Sbjct: 195 DLYAFVNYLAANHGLPKSQILQSVGAGTEPFTGSNAVFTTSSYQVS 240 >ref|XP_007697688.1| glycoside hydrolase family 12 protein [Bipolaris sorokiniana ND90Pr] gi|451852822|gb|EMD66116.1| glycoside hydrolase family 12 protein [Bipolaris sorokiniana ND90Pr] Length = 245 Score = 70.5 bits (171), Expect = 5e-10 Identities = 33/47 (70%), Positives = 39/47 (82%) Frame = -3 Query: 295 DLMVFVNYLTSKQGMPKTQILQSVGAGTEPFSGNNAVFTTSAYSLTQ 155 DLM F+ YLTSKQG+P +QIL S GAGTEPFSG+NA F TSA+SL + Sbjct: 198 DLMDFIKYLTSKQGLPSSQILISAGAGTEPFSGSNAKFVTSAFSLAE 244 >ref|XP_007706495.1| glycoside hydrolase family 12 protein [Bipolaris zeicola 26-R-13] gi|953433841|ref|XP_014558992.1| glycoside hydrolase family 12 protein [Bipolaris victoriae FI3] gi|576924989|gb|EUC39095.1| glycoside hydrolase family 12 protein [Bipolaris zeicola 26-R-13] gi|578492007|gb|EUN29410.1| glycoside hydrolase family 12 protein [Bipolaris victoriae FI3] Length = 245 Score = 69.7 bits (169), Expect = 8e-10 Identities = 33/47 (70%), Positives = 38/47 (80%) Frame = -3 Query: 295 DLMVFVNYLTSKQGMPKTQILQSVGAGTEPFSGNNAVFTTSAYSLTQ 155 DLM F+ YLTSKQG+P +QIL S GAGTEPFSG+NA TSAYSL + Sbjct: 198 DLMDFIKYLTSKQGLPSSQILISAGAGTEPFSGSNAKLVTSAYSLAE 244 >gb|ENH87033.1| endoglucanase a precursor [Colletotrichum orbiculare MAFF 240422] Length = 244 Score = 69.7 bits (169), Expect = 8e-10 Identities = 32/47 (68%), Positives = 37/47 (78%) Frame = -3 Query: 295 DLMVFVNYLTSKQGMPKTQILQSVGAGTEPFSGNNAVFTTSAYSLTQ 155 DL F YL + QG+P +QILQS+GAGTEPF G+NAVFTTSAYS Q Sbjct: 197 DLKAFATYLINSQGLPSSQILQSIGAGTEPFVGSNAVFTTSAYSAVQ 243 >ref|XP_014075771.1| glycoside hydrolase family 12 protein [Bipolaris maydis ATCC 48331] gi|452002388|gb|EMD94846.1| glycoside hydrolase family 12 protein [Bipolaris maydis C5] gi|477584771|gb|ENI01862.1| glycoside hydrolase family 12 protein [Bipolaris maydis ATCC 48331] Length = 245 Score = 69.7 bits (169), Expect = 8e-10 Identities = 33/47 (70%), Positives = 39/47 (82%) Frame = -3 Query: 295 DLMVFVNYLTSKQGMPKTQILQSVGAGTEPFSGNNAVFTTSAYSLTQ 155 DLM F+ YLTSKQG+P +QIL S GAGTEPFSG+NA F TSA+SL + Sbjct: 198 DLMDFLKYLTSKQGLPSSQILISAGAGTEPFSGSNAKFVTSAFSLAE 244 >emb|CCF44295.1| xyloglucan-specific endo-beta-1,4-glucanase A [Colletotrichum higginsianum] Length = 217 Score = 68.9 bits (167), Expect = 1e-09 Identities = 32/46 (69%), Positives = 39/46 (84%) Frame = -3 Query: 295 DLMVFVNYLTSKQGMPKTQILQSVGAGTEPFSGNNAVFTTSAYSLT 158 DLM F NYLTSKQG+ KT ++ S+ AGTEPFSGNNAVF TSAY+++ Sbjct: 170 DLMGFFNYLTSKQGVAKTNVVTSLQAGTEPFSGNNAVFKTSAYTIS 215 >ref|XP_001792584.1| hypothetical protein SNOG_01962 [Parastagonospora nodorum SN15] gi|111069054|gb|EAT90174.1| hypothetical protein SNOG_01962 [Parastagonospora nodorum SN15] Length = 249 Score = 68.9 bits (167), Expect = 1e-09 Identities = 32/48 (66%), Positives = 38/48 (79%) Frame = -3 Query: 295 DLMVFVNYLTSKQGMPKTQILQSVGAGTEPFSGNNAVFTTSAYSLTQT 152 DLM F NY G P TQILQSVGAGTEPFSG++AV TTSAY+++Q+ Sbjct: 202 DLMDFANYCIKSHGFPNTQILQSVGAGTEPFSGSDAVLTTSAYTMSQS 249 >gb|EQB54057.1| glycosyl hydrolase family 12 [Colletotrichum gloeosporioides Cg-14] Length = 244 Score = 68.6 bits (166), Expect = 2e-09 Identities = 31/44 (70%), Positives = 37/44 (84%) Frame = -3 Query: 295 DLMVFVNYLTSKQGMPKTQILQSVGAGTEPFSGNNAVFTTSAYS 164 DL FV YL + QG+P +QILQS+GAGTEPF G+NAVFTTSAY+ Sbjct: 197 DLKAFVTYLINSQGLPSSQILQSIGAGTEPFVGSNAVFTTSAYT 240 >ref|XP_007285310.1| xyloglucan-specific endo-beta-glucanase precursor [Colletotrichum gloeosporioides Nara gc5] gi|429850345|gb|ELA25631.1| xyloglucan-specific endo-beta-glucanase precursor [Colletotrichum gloeosporioides Nara gc5] Length = 225 Score = 68.6 bits (166), Expect = 2e-09 Identities = 31/44 (70%), Positives = 37/44 (84%) Frame = -3 Query: 295 DLMVFVNYLTSKQGMPKTQILQSVGAGTEPFSGNNAVFTTSAYS 164 DL FV YL + QG+P +QILQS+GAGTEPF G+NAVFTTSAY+ Sbjct: 178 DLKAFVTYLINSQGLPSSQILQSIGAGTEPFVGSNAVFTTSAYT 221 >ref|XP_007683939.1| glycoside hydrolase family 12 protein [Bipolaris oryzae ATCC 44560] gi|576935977|gb|EUC49476.1| glycoside hydrolase family 12 protein [Bipolaris oryzae ATCC 44560] Length = 245 Score = 68.2 bits (165), Expect = 2e-09 Identities = 32/47 (68%), Positives = 38/47 (80%) Frame = -3 Query: 295 DLMVFVNYLTSKQGMPKTQILQSVGAGTEPFSGNNAVFTTSAYSLTQ 155 DLM F+ YLTSKQG+P +QIL S GAGTEPFSG+NA TSA+SL + Sbjct: 198 DLMDFIKYLTSKQGLPSSQILISAGAGTEPFSGSNAKLVTSAFSLAE 244 >ref|XP_007597054.1| xyloglucan-specific endo-beta-1,4-glucanase A [Colletotrichum fioriniae PJ7] gi|588898238|gb|EXF79353.1| xyloglucan-specific endo-beta-1,4-glucanase A [Colletotrichum fioriniae PJ7] Length = 248 Score = 65.9 bits (159), Expect = 1e-08 Identities = 31/46 (67%), Positives = 37/46 (80%) Frame = -3 Query: 295 DLMVFVNYLTSKQGMPKTQILQSVGAGTEPFSGNNAVFTTSAYSLT 158 DL +F YLTSKQG+ KT ++ S+ AGTEPFSG NAVF TSAY+LT Sbjct: 201 DLNLFFTYLTSKQGVAKTNVITSLQAGTEPFSGTNAVFKTSAYTLT 246 >emb|CCF33542.1| endoglucanase-1 [Colletotrichum higginsianum] Length = 104 Score = 65.5 bits (158), Expect = 2e-08 Identities = 29/44 (65%), Positives = 36/44 (81%) Frame = -3 Query: 295 DLMVFVNYLTSKQGMPKTQILQSVGAGTEPFSGNNAVFTTSAYS 164 DL FV YL + QG+P +QILQS+GAGTEPF G+NA FTT+AY+ Sbjct: 57 DLKAFVTYLVNSQGLPSSQILQSIGAGTEPFVGSNAKFTTTAYT 100 >ref|XP_008098797.1| glycosyl hydrolase family 12 [Colletotrichum graminicola M1.001] gi|310799884|gb|EFQ34777.1| glycosyl hydrolase family 12 [Colletotrichum graminicola M1.001] Length = 244 Score = 65.5 bits (158), Expect = 2e-08 Identities = 30/44 (68%), Positives = 35/44 (79%) Frame = -3 Query: 295 DLMVFVNYLTSKQGMPKTQILQSVGAGTEPFSGNNAVFTTSAYS 164 DL FV YL QG+P +QILQS+GAGTEPF G+NA FTT+AYS Sbjct: 197 DLEAFVTYLVGSQGLPASQILQSIGAGTEPFVGSNAKFTTTAYS 240 >gb|KDN65886.1| putative glycosyl hydrolase family 12 [Colletotrichum sublineola] Length = 244 Score = 65.1 bits (157), Expect = 2e-08 Identities = 29/44 (65%), Positives = 36/44 (81%) Frame = -3 Query: 295 DLMVFVNYLTSKQGMPKTQILQSVGAGTEPFSGNNAVFTTSAYS 164 DL FV YL + QG+P +QILQS+GAGTEPF G+NA FTT+AY+ Sbjct: 197 DLKAFVTYLVASQGLPASQILQSIGAGTEPFVGSNAKFTTTAYT 240