BLASTX nr result
ID: Cornus23_contig00045761
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00045761 (289 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007830893.1| hypothetical protein PFICI_04121 [Pestalotio... 67 4e-09 dbj|GAP91375.1| putative glc8 protein [Rosellinia necatrix] 61 3e-07 ref|XP_003648555.1| hypothetical protein THITE_2072080 [Thielavi... 60 5e-07 ref|XP_001903150.1| hypothetical protein [Podospora anserina S m... 60 5e-07 gb|KFA64261.1| hypothetical protein S40285_06761 [Stachybotrys c... 60 6e-07 gb|KEZ39076.1| hypothetical protein SAPIO_CDS10461 [Scedosporium... 60 6e-07 gb|KEY66261.1| hypothetical protein S7711_09187 [Stachybotrys ch... 60 6e-07 gb|KOP47654.1| Uncharacterized protein MMYC01_G01922 [Madurella ... 60 8e-07 gb|ELQ39248.1| hypothetical protein OOU_Y34scaffold00511g38 [Mag... 60 8e-07 ref|XP_003661056.1| hypothetical protein MYCTH_2300012 [Myceliop... 60 8e-07 ref|XP_006695398.1| hypothetical protein CTHT_0050510 [Chaetomiu... 60 8e-07 ref|XP_001595667.1| hypothetical protein SS1G_03756 [Sclerotinia... 60 8e-07 ref|XP_003712286.1| hypothetical protein MGG_09466 [Magnaporthe ... 60 8e-07 ref|XP_003346304.1| hypothetical protein SMAC_07952 [Sordaria ma... 59 1e-06 gb|KDN67815.1| hypothetical protein CSUB01_04761 [Colletotrichum... 59 2e-06 ref|XP_007593884.1| hypothetical protein CFIO01_05211 [Colletotr... 59 2e-06 emb|CCF41167.1| hypothetical protein CH063_11527 [Colletotrichum... 59 2e-06 ref|XP_009848672.1| hypothetical protein NEUTE1DRAFT_120557 [Neu... 59 2e-06 ref|XP_008098921.1| hypothetical protein GLRG_10045 [Colletotric... 59 2e-06 ref|XP_011394734.1| hypothetical protein, variant [Neurospora cr... 59 2e-06 >ref|XP_007830893.1| hypothetical protein PFICI_04121 [Pestalotiopsis fici W106-1] gi|573066494|gb|ETS86096.1| hypothetical protein PFICI_04121 [Pestalotiopsis fici W106-1] Length = 252 Score = 67.4 bits (163), Expect = 4e-09 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -1 Query: 289 GMTAEEREKHRRFEELRKKHYEMSEAVGLLGHP 191 GM+ EEREKHRRFE+LRKKHYEMSEAVGLLGHP Sbjct: 189 GMSPEEREKHRRFEQLRKKHYEMSEAVGLLGHP 221 >dbj|GAP91375.1| putative glc8 protein [Rosellinia necatrix] Length = 245 Score = 61.2 bits (147), Expect = 3e-07 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -1 Query: 289 GMTAEEREKHRRFEELRKKHYEMSEAVGLLGHP 191 GMT EEREKH +FE+LRKKHYEM EAV LLGHP Sbjct: 185 GMTPEEREKHLKFEQLRKKHYEMKEAVNLLGHP 217 >ref|XP_003648555.1| hypothetical protein THITE_2072080 [Thielavia terrestris NRRL 8126] gi|346995816|gb|AEO62219.1| hypothetical protein THITE_2072080 [Thielavia terrestris NRRL 8126] Length = 703 Score = 60.5 bits (145), Expect = 5e-07 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = -1 Query: 289 GMTAEEREKHRRFEELRKKHYEMSEAVGLLGHP 191 G++AEEREKHRRFEE+RKKHYEM + LLGHP Sbjct: 238 GLSAEEREKHRRFEEMRKKHYEMKDVAALLGHP 270 >ref|XP_001903150.1| hypothetical protein [Podospora anserina S mat+] gi|170936263|emb|CAP60922.1| unnamed protein product [Podospora anserina S mat+] gi|681094808|emb|CDP24937.1| Putative protein of unknown function [Podospora anserina S mat+] Length = 395 Score = 60.5 bits (145), Expect = 5e-07 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = -1 Query: 289 GMTAEEREKHRRFEELRKKHYEMSEAVGLLGHP 191 GM+AEEREKHR+FEELRKKHYEM LLGHP Sbjct: 327 GMSAEEREKHRKFEELRKKHYEMKNVASLLGHP 359 >gb|KFA64261.1| hypothetical protein S40285_06761 [Stachybotrys chlorohalonata IBT 40285] Length = 270 Score = 60.1 bits (144), Expect = 6e-07 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = -1 Query: 289 GMTAEEREKHRRFEELRKKHYEMSEAVGLLGHP 191 G+TAEEREKHR+FEELRKKHYEM LLGHP Sbjct: 211 GLTAEEREKHRKFEELRKKHYEMGNVAQLLGHP 243 >gb|KEZ39076.1| hypothetical protein SAPIO_CDS10461 [Scedosporium apiospermum] Length = 281 Score = 60.1 bits (144), Expect = 6e-07 Identities = 27/33 (81%), Positives = 28/33 (84%) Frame = -1 Query: 289 GMTAEEREKHRRFEELRKKHYEMSEAVGLLGHP 191 GM+ EEREKHRRFEELRKKHYEM V LLGHP Sbjct: 212 GMSPEEREKHRRFEELRKKHYEMRNVVQLLGHP 244 >gb|KEY66261.1| hypothetical protein S7711_09187 [Stachybotrys chartarum IBT 7711] gi|667518494|gb|KFA47893.1| hypothetical protein S40293_05184 [Stachybotrys chartarum IBT 40293] gi|667741054|gb|KFA79908.1| hypothetical protein S40288_03743 [Stachybotrys chartarum IBT 40288] Length = 276 Score = 60.1 bits (144), Expect = 6e-07 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = -1 Query: 289 GMTAEEREKHRRFEELRKKHYEMSEAVGLLGHP 191 G+TAEEREKHR+FEELRKKHYEM LLGHP Sbjct: 218 GLTAEEREKHRKFEELRKKHYEMGNVAQLLGHP 250 >gb|KOP47654.1| Uncharacterized protein MMYC01_G01922 [Madurella mycetomatis] Length = 306 Score = 59.7 bits (143), Expect = 8e-07 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = -1 Query: 289 GMTAEEREKHRRFEELRKKHYEMSEAVGLLGHP 191 G++AEEREKHRRFEE+RKKHYEM LLGHP Sbjct: 238 GLSAEEREKHRRFEEMRKKHYEMKNVAALLGHP 270 >gb|ELQ39248.1| hypothetical protein OOU_Y34scaffold00511g38 [Magnaporthe oryzae Y34] gi|440485557|gb|ELQ65502.1| hypothetical protein OOW_P131scaffold00484g9 [Magnaporthe oryzae P131] Length = 256 Score = 59.7 bits (143), Expect = 8e-07 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = -1 Query: 289 GMTAEEREKHRRFEELRKKHYEMSEAVGLLGHP 191 G++AEEREKHR+FEE+RKKHYEM +A LLGHP Sbjct: 199 GLSAEEREKHRKFEEMRKKHYEMRDAAQLLGHP 231 >ref|XP_003661056.1| hypothetical protein MYCTH_2300012 [Myceliophthora thermophila ATCC 42464] gi|347008324|gb|AEO55811.1| hypothetical protein MYCTH_2300012 [Myceliophthora thermophila ATCC 42464] Length = 294 Score = 59.7 bits (143), Expect = 8e-07 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = -1 Query: 289 GMTAEEREKHRRFEELRKKHYEMSEAVGLLGHP 191 G++AEEREKHRRFEE+RKKHYEM LLGHP Sbjct: 226 GLSAEEREKHRRFEEMRKKHYEMKNVAALLGHP 258 >ref|XP_006695398.1| hypothetical protein CTHT_0050510 [Chaetomium thermophilum var. thermophilum DSM 1495] gi|340923550|gb|EGS18453.1| hypothetical protein CTHT_0050510 [Chaetomium thermophilum var. thermophilum DSM 1495] Length = 279 Score = 59.7 bits (143), Expect = 8e-07 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = -1 Query: 289 GMTAEEREKHRRFEELRKKHYEMSEAVGLLGHP 191 G++AEEREKHRRFEE+RKKHYEM LLGHP Sbjct: 213 GLSAEEREKHRRFEEMRKKHYEMKNVAALLGHP 245 >ref|XP_001595667.1| hypothetical protein SS1G_03756 [Sclerotinia sclerotiorum 1980] gi|154701543|gb|EDO01282.1| hypothetical protein SS1G_03756 [Sclerotinia sclerotiorum 1980 UF-70] Length = 278 Score = 59.7 bits (143), Expect = 8e-07 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = -1 Query: 289 GMTAEEREKHRRFEELRKKHYEMSEAVGLLGHP 191 GMT EEREKH RFEELR+KHY+M+ GLLGHP Sbjct: 232 GMTPEEREKHERFEELRRKHYDMANVAGLLGHP 264 >ref|XP_003712286.1| hypothetical protein MGG_09466 [Magnaporthe oryzae 70-15] gi|351644618|gb|EHA52479.1| hypothetical protein MGG_09466 [Magnaporthe oryzae 70-15] Length = 281 Score = 59.7 bits (143), Expect = 8e-07 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = -1 Query: 289 GMTAEEREKHRRFEELRKKHYEMSEAVGLLGHP 191 G++AEEREKHR+FEE+RKKHYEM +A LLGHP Sbjct: 224 GLSAEEREKHRKFEEMRKKHYEMRDAAQLLGHP 256 >ref|XP_003346304.1| hypothetical protein SMAC_07952 [Sordaria macrospora k-hell] gi|380088050|emb|CCC13883.1| unnamed protein product [Sordaria macrospora k-hell] Length = 311 Score = 59.3 bits (142), Expect = 1e-06 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = -1 Query: 289 GMTAEEREKHRRFEELRKKHYEMSEAVGLLGHP 191 GM AEEREKHR+FEE+RKKHYEM LLGHP Sbjct: 251 GMNAEEREKHRKFEEMRKKHYEMKSVASLLGHP 283 >gb|KDN67815.1| hypothetical protein CSUB01_04761 [Colletotrichum sublineola] Length = 272 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = -1 Query: 289 GMTAEEREKHRRFEELRKKHYEMSEAVGLLGHP 191 G++ EEREKHRRFEELRKKHYEM + LLGHP Sbjct: 204 GLSPEEREKHRRFEELRKKHYEMKDVAHLLGHP 236 >ref|XP_007593884.1| hypothetical protein CFIO01_05211 [Colletotrichum fioriniae PJ7] gi|588902110|gb|EXF82488.1| hypothetical protein CFIO01_05211 [Colletotrichum fioriniae PJ7] Length = 269 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = -1 Query: 289 GMTAEEREKHRRFEELRKKHYEMSEAVGLLGHP 191 G++ EEREKHRRFEELRKKHYEM + LLGHP Sbjct: 204 GLSPEEREKHRRFEELRKKHYEMKDVAHLLGHP 236 >emb|CCF41167.1| hypothetical protein CH063_11527 [Colletotrichum higginsianum] Length = 268 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = -1 Query: 289 GMTAEEREKHRRFEELRKKHYEMSEAVGLLGHP 191 G++ EEREKHRRFEELRKKHYEM + LLGHP Sbjct: 204 GLSPEEREKHRRFEELRKKHYEMKDVAHLLGHP 236 >ref|XP_009848672.1| hypothetical protein NEUTE1DRAFT_120557 [Neurospora tetrasperma FGSC 2508] gi|336473515|gb|EGO61675.1| hypothetical protein NEUTE1DRAFT_120557 [Neurospora tetrasperma FGSC 2508] gi|350293189|gb|EGZ74274.1| hypothetical protein NEUTE2DRAFT_102936 [Neurospora tetrasperma FGSC 2509] Length = 310 Score = 58.5 bits (140), Expect = 2e-06 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = -1 Query: 289 GMTAEEREKHRRFEELRKKHYEMSEAVGLLGHP 191 G++AEEREKHR+FEE+RKKHYEM LLGHP Sbjct: 250 GLSAEEREKHRKFEEMRKKHYEMKSVASLLGHP 282 >ref|XP_008098921.1| hypothetical protein GLRG_10045 [Colletotrichum graminicola M1.001] gi|310800008|gb|EFQ34901.1| hypothetical protein GLRG_10045 [Colletotrichum graminicola M1.001] Length = 271 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = -1 Query: 289 GMTAEEREKHRRFEELRKKHYEMSEAVGLLGHP 191 G++ EEREKHRRFEELRKKHYEM + LLGHP Sbjct: 204 GLSPEEREKHRRFEELRKKHYEMKDVAHLLGHP 236 >ref|XP_011394734.1| hypothetical protein, variant [Neurospora crassa OR74A] gi|758997338|ref|XP_011394735.1| hypothetical protein NCU08859 [Neurospora crassa OR74A] gi|18375959|emb|CAD21258.1| related to Glc8 protein [Neurospora crassa] gi|553135430|gb|ESA42339.1| hypothetical protein NCU08859 [Neurospora crassa OR74A] gi|553135431|gb|ESA42340.1| hypothetical protein, variant [Neurospora crassa OR74A] gi|725981000|gb|KHE84145.1| hypothetical protein GE21DRAFT_1273349 [Neurospora crassa] Length = 310 Score = 58.5 bits (140), Expect = 2e-06 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = -1 Query: 289 GMTAEEREKHRRFEELRKKHYEMSEAVGLLGHP 191 G++AEEREKHR+FEE+RKKHYEM LLGHP Sbjct: 250 GLSAEEREKHRKFEEMRKKHYEMKSVASLLGHP 282