BLASTX nr result
ID: Cornus23_contig00045760
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00045760 (280 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN73973.1| hypothetical protein VITISV_023797 [Vitis vinifera] 93 7e-17 ref|XP_013463478.1| hypothetical protein MTR_2g040760 [Medicago ... 75 1e-11 >emb|CAN73973.1| hypothetical protein VITISV_023797 [Vitis vinifera] Length = 291 Score = 93.2 bits (230), Expect = 7e-17 Identities = 46/52 (88%), Positives = 46/52 (88%) Frame = +3 Query: 3 CLGASLALREKARRIILYLPVPGHTPVRPQKRKSQCILPSRRSLEWECRGGK 158 CLGASLALREKARR IL LPVP HTPVRPQKRKSQCIL SRRSLEWEC GK Sbjct: 88 CLGASLALREKARRRILSLPVPDHTPVRPQKRKSQCILLSRRSLEWECSVGK 139 >ref|XP_013463478.1| hypothetical protein MTR_2g040760 [Medicago truncatula] gi|657397869|gb|KEH37513.1| hypothetical protein MTR_2g040760 [Medicago truncatula] Length = 343 Score = 75.5 bits (184), Expect = 1e-11 Identities = 39/53 (73%), Positives = 39/53 (73%) Frame = +1 Query: 1 PVLGRLWLYERKPAG*FFIFPSRVILRCDHRRGNRNASCPAGVAWSGSVAGVR 159 P GRLWLYE KPA FIF S RC HRRGNRNASC AGVAWSGSVA VR Sbjct: 51 PSPGRLWLYEIKPAIKVFIFSSWRRFRCVHRRGNRNASCSAGVAWSGSVAWVR 103