BLASTX nr result
ID: Cornus23_contig00045319
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00045319 (317 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006431225.1| hypothetical protein CICLE_v10011685mg [Citr... 62 1e-07 ref|XP_006431224.1| hypothetical protein CICLE_v10011685mg [Citr... 62 1e-07 gb|KDO72664.1| hypothetical protein CISIN_1g0139051mg, partial [... 62 2e-07 ref|XP_006482679.1| PREDICTED: BAG family molecular chaperone re... 62 2e-07 >ref|XP_006431225.1| hypothetical protein CICLE_v10011685mg [Citrus clementina] gi|557533282|gb|ESR44465.1| hypothetical protein CICLE_v10011685mg [Citrus clementina] Length = 458 Score = 62.4 bits (150), Expect = 1e-07 Identities = 28/42 (66%), Positives = 35/42 (83%) Frame = -1 Query: 317 AEGNYEISGQYKGQNGNFIFSAPLPVKMESKADLIKKSKAVK 192 AEG EI G YK ++G F+FSAP+PVKMES+ADL+KK KA+K Sbjct: 414 AEGRNEIDGDYKDEDGQFVFSAPVPVKMESRADLMKKRKALK 455 >ref|XP_006431224.1| hypothetical protein CICLE_v10011685mg [Citrus clementina] gi|557533281|gb|ESR44464.1| hypothetical protein CICLE_v10011685mg [Citrus clementina] Length = 418 Score = 62.4 bits (150), Expect = 1e-07 Identities = 28/42 (66%), Positives = 35/42 (83%) Frame = -1 Query: 317 AEGNYEISGQYKGQNGNFIFSAPLPVKMESKADLIKKSKAVK 192 AEG EI G YK ++G F+FSAP+PVKMES+ADL+KK KA+K Sbjct: 374 AEGRNEIDGDYKDEDGQFVFSAPVPVKMESRADLMKKRKALK 415 >gb|KDO72664.1| hypothetical protein CISIN_1g0139051mg, partial [Citrus sinensis] Length = 156 Score = 62.0 bits (149), Expect = 2e-07 Identities = 28/42 (66%), Positives = 35/42 (83%) Frame = -1 Query: 317 AEGNYEISGQYKGQNGNFIFSAPLPVKMESKADLIKKSKAVK 192 AEG EI G YK ++G F+FSAP+PVKMES+ADL+KK KA+K Sbjct: 112 AEGRNEIDGDYKVEDGQFVFSAPMPVKMESRADLMKKRKALK 153 >ref|XP_006482679.1| PREDICTED: BAG family molecular chaperone regulator 8, chloroplastic-like [Citrus sinensis] Length = 455 Score = 62.0 bits (149), Expect = 2e-07 Identities = 28/42 (66%), Positives = 35/42 (83%) Frame = -1 Query: 317 AEGNYEISGQYKGQNGNFIFSAPLPVKMESKADLIKKSKAVK 192 AEG EI G YK ++G F+FSAP+PVKMES+ADL+KK KA+K Sbjct: 411 AEGRNEIDGDYKVEDGQFVFSAPMPVKMESRADLMKKRKALK 452