BLASTX nr result
ID: Cornus23_contig00045311
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00045311 (567 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002534747.1| conserved hypothetical protein [Ricinus comm... 64 9e-14 gb|AIG89821.1| hypothetical protein (mitochondrion) [Capsicum an... 63 1e-08 >ref|XP_002534747.1| conserved hypothetical protein [Ricinus communis] gi|255604001|ref|XP_002538152.1| conserved hypothetical protein [Ricinus communis] gi|223513575|gb|EEF24232.1| conserved hypothetical protein [Ricinus communis] gi|223524644|gb|EEF27638.1| conserved hypothetical protein [Ricinus communis] Length = 126 Score = 63.9 bits (154), Expect(2) = 9e-14 Identities = 28/32 (87%), Positives = 28/32 (87%) Frame = +3 Query: 339 GSFSNKTKGGGSPHLHSHSMEEQLLNPHYNQS 434 G KTKGGGSPHLHSHSMEEQLLNPHYNQS Sbjct: 2 GILPQKTKGGGSPHLHSHSMEEQLLNPHYNQS 33 Score = 39.7 bits (91), Expect(2) = 9e-14 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = +1 Query: 487 LCWLFETKALIGMVLIPPSSLVWF 558 LCWLFE KALIGMVLIP LV F Sbjct: 56 LCWLFEAKALIGMVLIPMFFLVSF 79 >gb|AIG89821.1| hypothetical protein (mitochondrion) [Capsicum annuum] Length = 119 Score = 62.8 bits (151), Expect(2) = 1e-08 Identities = 42/72 (58%), Positives = 49/72 (68%), Gaps = 6/72 (8%) Frame = -2 Query: 557 NQTRLEGGISTIPMSAFV-----SKSQQRVSLYLGLGLASYIDLEK-GLVVVRIKELLLH 396 N+TR GISTI MSAFV +K++ + SLYLGLGLASYI LE LVVVR+ E LL+ Sbjct: 31 NETRKNMGISTIHMSAFVLSLRDNKTKGQPSLYLGLGLASYIALESIFLVVVRMLEQLLY 90 Query: 395 AVAVEVGAAASL 360 AV VE G L Sbjct: 91 AVGVEGGGCRRL 102 Score = 23.1 bits (48), Expect(2) = 1e-08 Identities = 9/10 (90%), Positives = 10/10 (100%) Frame = -1 Query: 567 RLSKPNETRR 538 RLSKPNETR+ Sbjct: 26 RLSKPNETRK 35