BLASTX nr result
ID: Cornus23_contig00045288
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00045288 (291 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007038409.1| Tetratricopeptide repeat-like superfamily pr... 76 9e-12 ref|XP_010264208.1| PREDICTED: pentatricopeptide repeat-containi... 69 1e-09 ref|XP_010264207.1| PREDICTED: pentatricopeptide repeat-containi... 69 1e-09 ref|XP_011082796.1| PREDICTED: pentatricopeptide repeat-containi... 66 1e-08 ref|XP_008439096.1| PREDICTED: pentatricopeptide repeat-containi... 65 2e-08 ref|XP_011043224.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 64 6e-08 ref|XP_004148164.2| PREDICTED: pentatricopeptide repeat-containi... 64 6e-08 ref|XP_002312829.1| pentatricopeptide repeat-containing family p... 64 6e-08 gb|KHG00793.1| hypothetical protein F383_22354 [Gossypium arboreum] 62 2e-07 ref|XP_012471024.1| PREDICTED: pentatricopeptide repeat-containi... 62 2e-07 ref|XP_012471023.1| PREDICTED: pentatricopeptide repeat-containi... 62 2e-07 ref|XP_012471028.1| PREDICTED: pentatricopeptide repeat-containi... 62 2e-07 ref|XP_012852100.1| PREDICTED: pentatricopeptide repeat-containi... 60 8e-07 ref|XP_006384788.1| hypothetical protein POPTR_0004s21110g [Popu... 60 8e-07 ref|XP_011006755.1| PREDICTED: pentatricopeptide repeat-containi... 59 1e-06 >ref|XP_007038409.1| Tetratricopeptide repeat-like superfamily protein, putative isoform 1 [Theobroma cacao] gi|590671720|ref|XP_007038410.1| Tetratricopeptide repeat-like superfamily protein, putative isoform 1 [Theobroma cacao] gi|590671723|ref|XP_007038411.1| Tetratricopeptide repeat-like superfamily protein, putative isoform 1 [Theobroma cacao] gi|508775654|gb|EOY22910.1| Tetratricopeptide repeat-like superfamily protein, putative isoform 1 [Theobroma cacao] gi|508775655|gb|EOY22911.1| Tetratricopeptide repeat-like superfamily protein, putative isoform 1 [Theobroma cacao] gi|508775656|gb|EOY22912.1| Tetratricopeptide repeat-like superfamily protein, putative isoform 1 [Theobroma cacao] Length = 1003 Score = 76.3 bits (186), Expect = 9e-12 Identities = 42/69 (60%), Positives = 51/69 (73%) Frame = +2 Query: 83 MIKKRPRSHELFLFIRTRKPFSTCPLPLDPPGPSVSTITYDHKSLCLSLADQLIRRGLLS 262 MIKKR S LF +TR+ +T LPLDP +VS+I DHKS CLSL +QLI+RGLLS Sbjct: 1 MIKKRLLS--CHLFFKTRRAITTSTLPLDPSFAAVSSICTDHKSFCLSLTEQLIKRGLLS 58 Query: 263 SAQRVIQRI 289 SAQ++IQRI Sbjct: 59 SAQQLIQRI 67 >ref|XP_010264208.1| PREDICTED: pentatricopeptide repeat-containing protein At5g62370 isoform X2 [Nelumbo nucifera] Length = 911 Score = 68.9 bits (167), Expect = 1e-09 Identities = 38/81 (46%), Positives = 51/81 (62%), Gaps = 12/81 (14%) Frame = +2 Query: 83 MIKKRPRSHELF------------LFIRTRKPFSTCPLPLDPPGPSVSTITYDHKSLCLS 226 MI K PR LF L R R+ STCPLP+D P + +T++ +H +LCLS Sbjct: 1 MITKWPRPCRLFSCSSNNNQSLASLVTRHRRTLSTCPLPVDVPISTSTTLSDEHNALCLS 60 Query: 227 LADQLIRRGLLSSAQRVIQRI 289 L +QLIRRGL+S+AQ V++RI Sbjct: 61 LVEQLIRRGLISAAQGVVERI 81 >ref|XP_010264207.1| PREDICTED: pentatricopeptide repeat-containing protein At5g62370 isoform X1 [Nelumbo nucifera] Length = 1000 Score = 68.9 bits (167), Expect = 1e-09 Identities = 38/81 (46%), Positives = 51/81 (62%), Gaps = 12/81 (14%) Frame = +2 Query: 83 MIKKRPRSHELF------------LFIRTRKPFSTCPLPLDPPGPSVSTITYDHKSLCLS 226 MI K PR LF L R R+ STCPLP+D P + +T++ +H +LCLS Sbjct: 1 MITKWPRPCRLFSCSSNNNQSLASLVTRHRRTLSTCPLPVDVPISTSTTLSDEHNALCLS 60 Query: 227 LADQLIRRGLLSSAQRVIQRI 289 L +QLIRRGL+S+AQ V++RI Sbjct: 61 LVEQLIRRGLISAAQGVVERI 81 >ref|XP_011082796.1| PREDICTED: pentatricopeptide repeat-containing protein At5g62370 [Sesamum indicum] gi|747071815|ref|XP_011082797.1| PREDICTED: pentatricopeptide repeat-containing protein At5g62370 [Sesamum indicum] gi|747071817|ref|XP_011082798.1| PREDICTED: pentatricopeptide repeat-containing protein At5g62370 [Sesamum indicum] Length = 986 Score = 65.9 bits (159), Expect = 1e-08 Identities = 38/65 (58%), Positives = 45/65 (69%), Gaps = 4/65 (6%) Frame = +2 Query: 107 HELFL--FIRTRKPFSTCPLPLDPPGPSVSTITYD--HKSLCLSLADQLIRRGLLSSAQR 274 H FL F+R R+ FS+CPLPL+P PS S+ K LC SLADQLI RGL SSAQ+ Sbjct: 4 HRAFLCKFVR-RRSFSSCPLPLEPQTPSFSSPASQITQKELCFSLADQLISRGLFSSAQK 62 Query: 275 VIQRI 289 VIQR+ Sbjct: 63 VIQRL 67 >ref|XP_008439096.1| PREDICTED: pentatricopeptide repeat-containing protein At5g62370 [Cucumis melo] gi|659077234|ref|XP_008439097.1| PREDICTED: pentatricopeptide repeat-containing protein At5g62370 [Cucumis melo] Length = 706 Score = 65.5 bits (158), Expect = 2e-08 Identities = 35/69 (50%), Positives = 46/69 (66%) Frame = +2 Query: 83 MIKKRPRSHELFLFIRTRKPFSTCPLPLDPPGPSVSTITYDHKSLCLSLADQLIRRGLLS 262 MI+ RP S + +L + R +TC +PLDPP S + +HK+LC SL +QLIRRGL Sbjct: 1 MIRGRP-SCKYYLSLNFRNLVTTCTVPLDPPTTSSFSSASEHKNLCFSLVEQLIRRGLFF 59 Query: 263 SAQRVIQRI 289 AQ+VIQRI Sbjct: 60 QAQQVIQRI 68 >ref|XP_011043224.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At5g62370-like [Populus euphratica] Length = 887 Score = 63.5 bits (153), Expect = 6e-08 Identities = 36/68 (52%), Positives = 43/68 (63%) Frame = +2 Query: 83 MIKKRPRSHELFLFIRTRKPFSTCPLPLDPPGPSVSTITYDHKSLCLSLADQLIRRGLLS 262 MIK+RP L+ + R STC +PLDP I+ DH SLC SL L+RRGLLS Sbjct: 1 MIKRRPFYRSLYFKPKKRPITSTCAVPLDP-----QPISNDHTSLCQSLVHDLLRRGLLS 55 Query: 263 SAQRVIQR 286 SAQ+VIQR Sbjct: 56 SAQQVIQR 63 >ref|XP_004148164.2| PREDICTED: pentatricopeptide repeat-containing protein At5g62370 [Cucumis sativus] gi|700202138|gb|KGN57271.1| hypothetical protein Csa_3G175715 [Cucumis sativus] Length = 706 Score = 63.5 bits (153), Expect = 6e-08 Identities = 34/69 (49%), Positives = 45/69 (65%) Frame = +2 Query: 83 MIKKRPRSHELFLFIRTRKPFSTCPLPLDPPGPSVSTITYDHKSLCLSLADQLIRRGLLS 262 MI+ RP S + +L + R +TC +PLDPP S + +HK+LC SL +QLIRRG Sbjct: 1 MIRGRP-SCKYYLSMNFRNLVTTCTVPLDPPTTSSFSSASEHKNLCFSLVEQLIRRGFFF 59 Query: 263 SAQRVIQRI 289 AQ+VIQRI Sbjct: 60 QAQQVIQRI 68 >ref|XP_002312829.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|222849237|gb|EEE86784.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 734 Score = 63.5 bits (153), Expect = 6e-08 Identities = 36/68 (52%), Positives = 43/68 (63%) Frame = +2 Query: 83 MIKKRPRSHELFLFIRTRKPFSTCPLPLDPPGPSVSTITYDHKSLCLSLADQLIRRGLLS 262 MIK+RP L+ + R STC +PLDP I+ DH SLC SL L+RRGLLS Sbjct: 1 MIKRRPFYRSLYFKPKKRPITSTCAVPLDP-----QPISNDHTSLCQSLVHDLLRRGLLS 55 Query: 263 SAQRVIQR 286 SAQ+VIQR Sbjct: 56 SAQQVIQR 63 >gb|KHG00793.1| hypothetical protein F383_22354 [Gossypium arboreum] Length = 998 Score = 62.0 bits (149), Expect = 2e-07 Identities = 35/70 (50%), Positives = 47/70 (67%), Gaps = 1/70 (1%) Frame = +2 Query: 83 MIKKRPRSHELFLFIRTRKPFST-CPLPLDPPGPSVSTITYDHKSLCLSLADQLIRRGLL 259 M KR S LF +TR+ +T LPLDP ++S+I DH SLCLS ++QLI RGLL Sbjct: 1 MTNKRVLSRHLFF--KTRRAVTTSAALPLDPSYATISSIPADHFSLCLSFSEQLINRGLL 58 Query: 260 SSAQRVIQRI 289 SSA+++ QR+ Sbjct: 59 SSARKLFQRV 68 >ref|XP_012471024.1| PREDICTED: pentatricopeptide repeat-containing protein At5g62370 isoform X2 [Gossypium raimondii] gi|823142449|ref|XP_012471025.1| PREDICTED: pentatricopeptide repeat-containing protein At5g62370 isoform X2 [Gossypium raimondii] gi|823142451|ref|XP_012471026.1| PREDICTED: pentatricopeptide repeat-containing protein At5g62370 isoform X2 [Gossypium raimondii] gi|823142453|ref|XP_012471027.1| PREDICTED: pentatricopeptide repeat-containing protein At5g62370 isoform X2 [Gossypium raimondii] Length = 988 Score = 61.6 bits (148), Expect = 2e-07 Identities = 35/69 (50%), Positives = 45/69 (65%) Frame = +2 Query: 83 MIKKRPRSHELFLFIRTRKPFSTCPLPLDPPGPSVSTITYDHKSLCLSLADQLIRRGLLS 262 M KR S LF F R ++ LPLDP +VS+I DH SLCLS ++QLI RGLLS Sbjct: 1 MTNKRVLSRHLF-FKSRRAVTTSAALPLDPSYATVSSIPADHFSLCLSFSEQLINRGLLS 59 Query: 263 SAQRVIQRI 289 SA+++ QR+ Sbjct: 60 SARKLFQRV 68 >ref|XP_012471023.1| PREDICTED: pentatricopeptide repeat-containing protein At5g62370 isoform X1 [Gossypium raimondii] Length = 994 Score = 61.6 bits (148), Expect = 2e-07 Identities = 35/69 (50%), Positives = 45/69 (65%) Frame = +2 Query: 83 MIKKRPRSHELFLFIRTRKPFSTCPLPLDPPGPSVSTITYDHKSLCLSLADQLIRRGLLS 262 M KR S LF F R ++ LPLDP +VS+I DH SLCLS ++QLI RGLLS Sbjct: 1 MTNKRVLSRHLF-FKSRRAVTTSAALPLDPSYATVSSIPADHFSLCLSFSEQLINRGLLS 59 Query: 263 SAQRVIQRI 289 SA+++ QR+ Sbjct: 60 SARKLFQRV 68 >ref|XP_012471028.1| PREDICTED: pentatricopeptide repeat-containing protein At5g62370 isoform X3 [Gossypium raimondii] gi|823142457|ref|XP_012471029.1| PREDICTED: pentatricopeptide repeat-containing protein At5g62370 isoform X3 [Gossypium raimondii] gi|823142459|ref|XP_012471030.1| PREDICTED: pentatricopeptide repeat-containing protein At5g62370 isoform X3 [Gossypium raimondii] gi|763752296|gb|KJB19684.1| hypothetical protein B456_003G114200 [Gossypium raimondii] Length = 915 Score = 61.6 bits (148), Expect = 2e-07 Identities = 35/69 (50%), Positives = 45/69 (65%) Frame = +2 Query: 83 MIKKRPRSHELFLFIRTRKPFSTCPLPLDPPGPSVSTITYDHKSLCLSLADQLIRRGLLS 262 M KR S LF F R ++ LPLDP +VS+I DH SLCLS ++QLI RGLLS Sbjct: 1 MTNKRVLSRHLF-FKSRRAVTTSAALPLDPSYATVSSIPADHFSLCLSFSEQLINRGLLS 59 Query: 263 SAQRVIQRI 289 SA+++ QR+ Sbjct: 60 SARKLFQRV 68 >ref|XP_012852100.1| PREDICTED: pentatricopeptide repeat-containing protein At5g62370 [Erythranthe guttatus] Length = 978 Score = 59.7 bits (143), Expect = 8e-07 Identities = 37/71 (52%), Positives = 47/71 (66%), Gaps = 2/71 (2%) Frame = +2 Query: 83 MIKKRPRSHELFLFIRTRKPFSTCPLPLDPPGPSVSTITYD--HKSLCLSLADQLIRRGL 256 MIK+R L F+R R+ FS+CPLP +P S S+ K LC SLADQL+ RGL Sbjct: 1 MIKQR---FLLSKFVR-RRTFSSCPLPFEPKTTSFSSSPSQITQKDLCFSLADQLMSRGL 56 Query: 257 LSSAQRVIQRI 289 +SSAQ+VIQR+ Sbjct: 57 VSSAQKVIQRL 67 >ref|XP_006384788.1| hypothetical protein POPTR_0004s21110g [Populus trichocarpa] gi|550341556|gb|ERP62585.1| hypothetical protein POPTR_0004s21110g [Populus trichocarpa] Length = 1025 Score = 59.7 bits (143), Expect = 8e-07 Identities = 34/68 (50%), Positives = 41/68 (60%) Frame = +2 Query: 83 MIKKRPRSHELFLFIRTRKPFSTCPLPLDPPGPSVSTITYDHKSLCLSLADQLIRRGLLS 262 MIK+RP H L+ + STC + LDP I DH SLC SL L+RRGLLS Sbjct: 1 MIKRRPFCHALYFKPKKGPITSTCAVSLDP-----QPIPNDHTSLCQSLVHDLLRRGLLS 55 Query: 263 SAQRVIQR 286 SAQ+V+QR Sbjct: 56 SAQQVVQR 63 >ref|XP_011006755.1| PREDICTED: pentatricopeptide repeat-containing protein At5g62370-like [Populus euphratica] Length = 664 Score = 59.3 bits (142), Expect = 1e-06 Identities = 34/68 (50%), Positives = 41/68 (60%) Frame = +2 Query: 83 MIKKRPRSHELFLFIRTRKPFSTCPLPLDPPGPSVSTITYDHKSLCLSLADQLIRRGLLS 262 MIK+RP H L+ + STC + LDP I DH SLC SL L+RRGLLS Sbjct: 1 MIKRRPFCHALYFKPKKGTITSTCAVSLDP-----HPIPNDHTSLCQSLVHDLLRRGLLS 55 Query: 263 SAQRVIQR 286 SAQ+V+QR Sbjct: 56 SAQQVVQR 63