BLASTX nr result
ID: Cornus23_contig00045254
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00045254 (345 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_005852283.1| hypothetical protein CHLNCDRAFT_33710 [Chlor... 67 7e-09 gb|KDD76611.1| hypothetical protein H632_c162p1 [Helicosporidium... 63 8e-08 ref|XP_005648904.1| CBS-domain-containing protein [Coccomyxa sub... 62 1e-07 ref|XP_011395691.1| CBS domain-containing protein CBSX3, mitocho... 62 2e-07 ref|NP_001150216.1| CBS domain protein [Zea mays] gi|670360316|r... 59 1e-06 gb|AAU93534.1| unknown protein [Zea mays] gi|414872653|tpg|DAA51... 59 1e-06 emb|CBB36473.1| Arabidopsis protein targeted to mitochondria pro... 59 1e-06 gb|KMZ67103.1| CBS domain-containing protein CBSX3, mitochondria... 58 2e-06 emb|CDI66516.1| CBS domain-containing protein [Saccharum hybrid ... 58 2e-06 emb|CBB36496.1| Arabidopsis protein targeted to mitochondria pro... 58 2e-06 ref|XP_010909683.1| PREDICTED: CBS domain-containing protein CBS... 57 4e-06 ref|XP_009374423.1| PREDICTED: CBS domain-containing protein CBS... 57 5e-06 ref|XP_008384645.1| PREDICTED: CBS domain-containing protein CBS... 57 5e-06 ref|XP_002319991.1| hypothetical protein POPTR_0013s15730g [Popu... 57 7e-06 >ref|XP_005852283.1| hypothetical protein CHLNCDRAFT_33710 [Chlorella variabilis] gi|307111947|gb|EFN60181.1| hypothetical protein CHLNCDRAFT_33710 [Chlorella variabilis] Length = 218 Score = 66.6 bits (161), Expect = 7e-09 Identities = 33/59 (55%), Positives = 42/59 (71%) Frame = -3 Query: 343 SVHHAMSLMVEQGFRHVPVVDPAQGAYMGMLSMRDVMVTLNAEHHEETDRLKDYIQGGY 167 SV M LMVE+ FRHVPV+D G+ GM+S+RDV+ T+ EH +E DRL +YIQG Y Sbjct: 162 SVLDVMELMVEKNFRHVPVMD--SGSMQGMVSIRDVVHTMLKEHRQEVDRLNEYIQGSY 218 >gb|KDD76611.1| hypothetical protein H632_c162p1 [Helicosporidium sp. ATCC 50920] Length = 207 Score = 63.2 bits (152), Expect = 8e-08 Identities = 33/59 (55%), Positives = 40/59 (67%) Frame = -3 Query: 343 SVHHAMSLMVEQGFRHVPVVDPAQGAYMGMLSMRDVMVTLNAEHHEETDRLKDYIQGGY 167 SV M LMV++ FRHVPVVD QG GM SMRDV+ + EH EE RL++YIQG + Sbjct: 150 SVLDVMELMVQRNFRHVPVVDE-QGVMQGMASMRDVVHIMLKEHREEVGRLQEYIQGTF 207 >ref|XP_005648904.1| CBS-domain-containing protein [Coccomyxa subellipsoidea C-169] gi|384250881|gb|EIE24360.1| CBS-domain-containing protein [Coccomyxa subellipsoidea C-169] Length = 230 Score = 62.4 bits (150), Expect = 1e-07 Identities = 32/59 (54%), Positives = 39/59 (66%) Frame = -3 Query: 343 SVHHAMSLMVEQGFRHVPVVDPAQGAYMGMLSMRDVMVTLNAEHHEETDRLKDYIQGGY 167 SV M LM E FRHVPVV +G Y+GM+S+RDV+ + EH EE RL +YIQG Y Sbjct: 174 SVVDVMKLMTENNFRHVPVVH--EGKYLGMVSIRDVVHVVVEEHKEEVGRLHEYIQGSY 230 >ref|XP_011395691.1| CBS domain-containing protein CBSX3, mitochondrial [Auxenochlorella protothecoides] gi|675350385|gb|KFM22825.1| CBS domain-containing protein CBSX3, mitochondrial [Auxenochlorella protothecoides] Length = 336 Score = 61.6 bits (148), Expect = 2e-07 Identities = 31/59 (52%), Positives = 40/59 (67%) Frame = -3 Query: 343 SVHHAMSLMVEQGFRHVPVVDPAQGAYMGMLSMRDVMVTLNAEHHEETDRLKDYIQGGY 167 SV M LM+ + FRHVPVVD +G +GM SMRDV+ + EH EE RL++YIQG + Sbjct: 280 SVLDVMELMINKNFRHVPVVD--EGRLLGMASMRDVVHVMLKEHREEVGRLQEYIQGTF 336 >ref|NP_001150216.1| CBS domain protein [Zea mays] gi|670360316|ref|XP_008677787.1| PREDICTED: CBS domain protein isoform X1 [Zea mays] gi|194708182|gb|ACF88175.1| unknown [Zea mays] gi|195613652|gb|ACG28656.1| CBS domain protein [Zea mays] gi|195637616|gb|ACG38276.1| CBS domain protein [Zea mays] gi|414872655|tpg|DAA51212.1| TPA: CBS domain protein isoform 1 [Zea mays] gi|414872656|tpg|DAA51213.1| TPA: CBS domain protein isoform 2 [Zea mays] gi|414872657|tpg|DAA51214.1| TPA: CBS domain protein isoform 3 [Zea mays] Length = 205 Score = 58.9 bits (141), Expect = 1e-06 Identities = 30/58 (51%), Positives = 38/58 (65%) Frame = -3 Query: 340 VHHAMSLMVEQGFRHVPVVDPAQGAYMGMLSMRDVMVTLNAEHHEETDRLKDYIQGGY 167 V AM LM E RH+PV+D +GM+S+ DV+ + AEH EE +RL DYIQGGY Sbjct: 150 VLQAMQLMTENRVRHIPVIDGT--GMLGMVSIGDVVRAVVAEHREELNRLNDYIQGGY 205 >gb|AAU93534.1| unknown protein [Zea mays] gi|414872653|tpg|DAA51210.1| TPA: putative uncharacterized protein adh1F [Zea mays] Length = 286 Score = 58.9 bits (141), Expect = 1e-06 Identities = 30/58 (51%), Positives = 38/58 (65%) Frame = -3 Query: 340 VHHAMSLMVEQGFRHVPVVDPAQGAYMGMLSMRDVMVTLNAEHHEETDRLKDYIQGGY 167 V AM LM E RH+PV+D +GM+S+ DV+ + AEH EE +RL DYIQGGY Sbjct: 231 VLQAMQLMTENRVRHIPVIDGT--GMLGMVSIGDVVRAVVAEHREELNRLNDYIQGGY 286 >emb|CBB36473.1| Arabidopsis protein targeted to mitochondria proteins At5g10860 [Saccharum hybrid cultivar R570] gi|727345955|emb|CDI66535.1| CBS domain-containing protein [Saccharum hybrid cultivar R570] Length = 205 Score = 58.9 bits (141), Expect = 1e-06 Identities = 29/58 (50%), Positives = 39/58 (67%) Frame = -3 Query: 340 VHHAMSLMVEQGFRHVPVVDPAQGAYMGMLSMRDVMVTLNAEHHEETDRLKDYIQGGY 167 V AM LM + RH+PV+D + +GM+S+ DV+ + AEH EE +RL DYIQGGY Sbjct: 150 VLQAMQLMTDNRIRHIPVIDGTE--MLGMVSIGDVVRAVVAEHREELNRLNDYIQGGY 205 >gb|KMZ67103.1| CBS domain-containing protein CBSX3, mitochondrial [Zostera marina] Length = 205 Score = 58.2 bits (139), Expect = 2e-06 Identities = 29/58 (50%), Positives = 38/58 (65%) Frame = -3 Query: 340 VHHAMSLMVEQGFRHVPVVDPAQGAYMGMLSMRDVMVTLNAEHHEETDRLKDYIQGGY 167 V AM LM + RH+PV+D +G +GMLS+ DV+ + EH EE DRL +IQGGY Sbjct: 149 VLRAMQLMTDNRIRHIPVIDDVKGM-LGMLSIGDVVRAVVIEHREELDRLSAFIQGGY 205 >emb|CDI66516.1| CBS domain-containing protein [Saccharum hybrid cultivar R570] gi|727345941|emb|CDI66522.1| CBS domain-containing protein [Saccharum hybrid cultivar R570] gi|727345969|emb|CDI66548.1| CBS domain-containing protein [Saccharum hybrid cultivar R570] gi|727345983|emb|CDI66560.1| CBS domain-containing protein [Saccharum hybrid cultivar R570] gi|727346004|emb|CDI66579.1| CBS domain-containing protein [Saccharum hybrid cultivar R570] gi|727346024|emb|CDI66596.1| CBS domain-containing protein [Saccharum hybrid cultivar R570] gi|727346045|emb|CDI66615.1| CBS domain-containing protein [Saccharum hybrid cultivar R570] Length = 205 Score = 58.2 bits (139), Expect = 2e-06 Identities = 29/58 (50%), Positives = 38/58 (65%) Frame = -3 Query: 340 VHHAMSLMVEQGFRHVPVVDPAQGAYMGMLSMRDVMVTLNAEHHEETDRLKDYIQGGY 167 V AM LM + RH+PV+D +GM+S+ DV+ + AEH EE +RL DYIQGGY Sbjct: 150 VLQAMQLMTDNRIRHIPVIDGT--GMLGMVSIGDVVRAVVAEHREELNRLNDYIQGGY 205 >emb|CBB36496.1| Arabidopsis protein targeted to mitochondria proteins At5g10860 [Saccharum hybrid cultivar R570] Length = 205 Score = 58.2 bits (139), Expect = 2e-06 Identities = 29/58 (50%), Positives = 38/58 (65%) Frame = -3 Query: 340 VHHAMSLMVEQGFRHVPVVDPAQGAYMGMLSMRDVMVTLNAEHHEETDRLKDYIQGGY 167 V AM LM + RH+PV+D +GM+S+ DV+ + AEH EE +RL DYIQGGY Sbjct: 150 VLQAMQLMTDNRIRHIPVIDGT--GMLGMVSIGDVVRAVVAEHREELNRLNDYIQGGY 205 >ref|XP_010909683.1| PREDICTED: CBS domain-containing protein CBSX3, mitochondrial [Elaeis guineensis] Length = 205 Score = 57.4 bits (137), Expect = 4e-06 Identities = 31/58 (53%), Positives = 39/58 (67%) Frame = -3 Query: 340 VHHAMSLMVEQGFRHVPVVDPAQGAYMGMLSMRDVMVTLNAEHHEETDRLKDYIQGGY 167 V AM LM + RH+PV+D A+G MGM+S+ DV+ + EH EE DRL YIQGGY Sbjct: 150 VLQAMQLMTDNRIRHIPVID-AKGM-MGMVSIGDVVRAVVTEHREELDRLNAYIQGGY 205 >ref|XP_009374423.1| PREDICTED: CBS domain-containing protein CBSX3, mitochondrial-like [Pyrus x bretschneideri] gi|694398494|ref|XP_009374424.1| PREDICTED: CBS domain-containing protein CBSX3, mitochondrial-like [Pyrus x bretschneideri] Length = 207 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/58 (48%), Positives = 38/58 (65%) Frame = -3 Query: 340 VHHAMSLMVEQGFRHVPVVDPAQGAYMGMLSMRDVMVTLNAEHHEETDRLKDYIQGGY 167 V AM LM + RH+PV+D G +GM+S+ DV+ + +EH EE DRL +IQGGY Sbjct: 152 VLRAMQLMTDNRIRHIPVID--NGGMIGMVSIGDVVRAVVSEHREELDRLNAFIQGGY 207 >ref|XP_008384645.1| PREDICTED: CBS domain-containing protein CBSX3, mitochondrial-like [Malus domestica] gi|657985085|ref|XP_008384646.1| PREDICTED: CBS domain-containing protein CBSX3, mitochondrial-like [Malus domestica] gi|658028170|ref|XP_008349515.1| PREDICTED: CBS domain-containing protein CBSX3, mitochondrial-like [Malus domestica] Length = 207 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/58 (48%), Positives = 38/58 (65%) Frame = -3 Query: 340 VHHAMSLMVEQGFRHVPVVDPAQGAYMGMLSMRDVMVTLNAEHHEETDRLKDYIQGGY 167 V AM LM + RH+PV+D G +GM+S+ DV+ + +EH EE DRL +IQGGY Sbjct: 152 VLRAMQLMTDNRIRHIPVID--NGGMIGMVSIGDVVRAVVSEHREELDRLNAFIQGGY 207 >ref|XP_002319991.1| hypothetical protein POPTR_0013s15730g [Populus trichocarpa] gi|566201546|ref|XP_006376574.1| hypothetical protein POPTR_0013s15730g [Populus trichocarpa] gi|222858367|gb|EEE95914.1| hypothetical protein POPTR_0013s15730g [Populus trichocarpa] gi|550325940|gb|ERP54371.1| hypothetical protein POPTR_0013s15730g [Populus trichocarpa] Length = 205 Score = 56.6 bits (135), Expect = 7e-06 Identities = 27/55 (49%), Positives = 38/55 (69%) Frame = -3 Query: 331 AMSLMVEQGFRHVPVVDPAQGAYMGMLSMRDVMVTLNAEHHEETDRLKDYIQGGY 167 AM LM ++ RH+PV+D + +GM+S+ DV+ + +EH EE DRL YIQGGY Sbjct: 153 AMQLMTDKRIRHIPVIDDKE--MIGMVSIGDVVRAVVSEHREEVDRLNAYIQGGY 205