BLASTX nr result
ID: Cornus23_contig00045136
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00045136 (318 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAM82017.1| hypothetical protein ANO11243_000001 [fungal sp.... 64 3e-08 >dbj|GAM82017.1| hypothetical protein ANO11243_000001 [fungal sp. No.11243] Length = 482 Score = 64.3 bits (155), Expect = 3e-08 Identities = 37/60 (61%), Positives = 45/60 (75%), Gaps = 1/60 (1%) Frame = -3 Query: 217 ISALINGAQSASEDQ-RRSGSVSPTSKTGRQLQDIPLHKLGFNPGSDARALSALDKATFR 41 I++LINGAQ+A ++Q RRSGS+SP S+ L DI LHK GFN SD RAL LD+ATFR Sbjct: 425 ITSLINGAQAAIDEQNRRSGSISPGSQA---LPDITLHKSGFNHHSDVRALRDLDRATFR 481