BLASTX nr result
ID: Cornus23_contig00045015
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00045015 (332 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003848865.1| hypothetical protein MYCGRDRAFT_76293 [Zymos... 62 1e-07 gb|EMF15293.1| cytochrome c oxidase subunit IV [Sphaerulina musi... 56 9e-06 >ref|XP_003848865.1| hypothetical protein MYCGRDRAFT_76293 [Zymoseptoria tritici IPO323] gi|339468741|gb|EGP83841.1| hypothetical protein MYCGRDRAFT_76293 [Zymoseptoria tritici IPO323] gi|796710648|gb|KJY01587.1| mitochondrial cytochrome c oxidase subunit V like protein [Zymoseptoria brevis] Length = 181 Score = 62.4 bits (150), Expect = 1e-07 Identities = 35/57 (61%), Positives = 37/57 (64%), Gaps = 2/57 (3%) Frame = -3 Query: 234 MLRTSPLLRQLPATLQSGXXXXXXXXXXXXXXXQ--IRCAHAISNPTLANIEKRWEA 70 MLRT+PLLRQLPAT+QSG R AHAISNPTLANIEKRWEA Sbjct: 1 MLRTAPLLRQLPATVQSGRTAAATFAPFARQSSLQQTRSAHAISNPTLANIEKRWEA 57 >gb|EMF15293.1| cytochrome c oxidase subunit IV [Sphaerulina musiva SO2202] Length = 172 Score = 56.2 bits (134), Expect = 9e-06 Identities = 31/55 (56%), Positives = 34/55 (61%) Frame = -3 Query: 234 MLRTSPLLRQLPATLQSGXXXXXXXXXXXXXXXQIRCAHAISNPTLANIEKRWEA 70 MLRT+PLLRQ +L S +RCAHAISNPTLANIEKRWEA Sbjct: 1 MLRTTPLLRQSLTSLSSARNHTLQQ---------VRCAHAISNPTLANIEKRWEA 46