BLASTX nr result
ID: Cornus23_contig00044941
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00044941 (266 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003615432.1| hypothetical protein MTR_5g067940 [Medicago ... 74 1e-17 ref|XP_003605622.1| hypothetical protein MTR_4g035030 [Medicago ... 75 1e-12 gb|KJB23821.1| hypothetical protein B456_004G116300 [Gossypium r... 57 4e-06 tpg|DAA62789.1| TPA: hypothetical protein ZEAMMB73_456670 [Zea m... 57 7e-06 >ref|XP_003615432.1| hypothetical protein MTR_5g067940 [Medicago truncatula] gi|355516767|gb|AES98390.1| hypothetical protein MTR_5g067940 [Medicago truncatula] Length = 69 Score = 73.9 bits (180), Expect(2) = 1e-17 Identities = 39/45 (86%), Positives = 40/45 (88%) Frame = -2 Query: 265 AKSVDATDLIGLSLGMETY*VITFKFRETLELIKMGNPEPNPVFR 131 A+ VDATDLIGLSLGMETY V TFKFRETLEL KMGNPEPNP FR Sbjct: 2 AELVDATDLIGLSLGMETYQVKTFKFRETLEL-KMGNPEPNPSFR 45 Score = 42.7 bits (99), Expect(2) = 1e-17 Identities = 19/21 (90%), Positives = 19/21 (90%) Frame = -1 Query: 125 NKGSESENKKRIGAETQWKLF 63 NK ESENKKRIGAETQWKLF Sbjct: 49 NKSLESENKKRIGAETQWKLF 69 >ref|XP_003605622.1| hypothetical protein MTR_4g035030 [Medicago truncatula] gi|355506677|gb|AES87819.1| hypothetical protein MTR_4g035030 [Medicago truncatula] Length = 95 Score = 75.5 bits (184), Expect(2) = 1e-12 Identities = 40/45 (88%), Positives = 40/45 (88%) Frame = -2 Query: 265 AKSVDATDLIGLSLGMETY*VITFKFRETLELIKMGNPEPNPVFR 131 AK VDATDLIGLSLGMETY V TFKFRETLEL KMGNPEPNP FR Sbjct: 2 AKLVDATDLIGLSLGMETYQVKTFKFRETLEL-KMGNPEPNPSFR 45 Score = 23.9 bits (50), Expect(2) = 1e-12 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = -1 Query: 125 NKGSESENKKRIG 87 NK ESEN+KRIG Sbjct: 49 NKSLESENQKRIG 61 >gb|KJB23821.1| hypothetical protein B456_004G116300 [Gossypium raimondii] Length = 34 Score = 57.4 bits (137), Expect = 4e-06 Identities = 29/36 (80%), Positives = 30/36 (83%) Frame = -1 Query: 260 IGRRYGLNWIEPWYGNLLSDNFQIQRNPGINKNGQS 153 IGR LNWIE WYGNL SDNFQIQRNPG+ KNGQS Sbjct: 3 IGR---LNWIESWYGNLRSDNFQIQRNPGM-KNGQS 34 >tpg|DAA62789.1| TPA: hypothetical protein ZEAMMB73_456670 [Zea mays] Length = 73 Score = 56.6 bits (135), Expect = 7e-06 Identities = 30/39 (76%), Positives = 31/39 (79%) Frame = +1 Query: 130 FGKQDLAQDCPFLLIPGFL*I*KLSLSRFPYQGSIQLSP 246 F K+DLAQDCPF I GFL I KL LSRFPYQGSIQ SP Sbjct: 36 FSKKDLAQDCPFF-IRGFLGIWKLPLSRFPYQGSIQSSP 73