BLASTX nr result
ID: Cornus23_contig00044857
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00044857 (413 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KIV80317.1| hypothetical protein PV11_07827 [Exophiala sideris] 69 1e-09 gb|KIV87583.1| hypothetical protein PV11_03117 [Exophiala sideris] 59 1e-06 >gb|KIV80317.1| hypothetical protein PV11_07827 [Exophiala sideris] Length = 227 Score = 68.9 bits (167), Expect = 1e-09 Identities = 39/68 (57%), Positives = 44/68 (64%), Gaps = 2/68 (2%) Frame = -2 Query: 367 LAVAIAAFSYPVVIQGAPNMNLEPRAG-VCSSGIYGELAPLLAGYSAAQAFCSQVYPVK- 194 LA+ + +YPVV LEPR G VC SGIYGELAP+LA Y A+AFCS VYPVK Sbjct: 7 LALTLVVLNYPVVNVATYFPALEPRTGGVCGSGIYGELAPILAAYPIAEAFCSAVYPVKR 66 Query: 193 CPVKAQKR 170 KA KR Sbjct: 67 TTAKAVKR 74 >gb|KIV87583.1| hypothetical protein PV11_03117 [Exophiala sideris] Length = 397 Score = 58.9 bits (141), Expect = 1e-06 Identities = 33/65 (50%), Positives = 36/65 (55%) Frame = -2 Query: 385 MSVKSFLAVAIAAFSYPVVIQGAPNMNLEPRAGVCSSGIYGELAPLLAGYSAAQAFCSQV 206 M K LA A A P AP + + A VCSSGIYGEL P LA YS A A CS Sbjct: 1 MMYKQILASAFLAMCLPQGSFAAPQLEVRSEA-VCSSGIYGELKPYLASYSVALAGCSAT 59 Query: 205 YPVKC 191 YPV+C Sbjct: 60 YPVEC 64