BLASTX nr result
ID: Cornus23_contig00044801
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00044801 (294 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJK73654.1| hypothetical protein H634G_11070 [Metarhizium ani... 57 7e-06 >gb|KJK73654.1| hypothetical protein H634G_11070 [Metarhizium anisopliae BRIP 53293] gi|770400739|gb|KJK85941.1| hypothetical protein H633G_10216 [Metarhizium anisopliae BRIP 53284] Length = 720 Score = 56.6 bits (135), Expect = 7e-06 Identities = 35/93 (37%), Positives = 51/93 (54%), Gaps = 3/93 (3%) Frame = -3 Query: 289 IDLEHNYPTPYIRYLTVTRSPGIHKYI---LCRLIPAEIYRHLLSPGIPDVNLFVKHQVY 119 + + H + PY + SP + + I + P+EIYR + IP+ +HQVY Sbjct: 79 VSIHHQWHMPYE---DIELSPVVQEVINSLVSTKTPSEIYREIRQ--IPEGKSVTRHQVY 133 Query: 118 YQWQHANSRI*RRDLDQFVSATKLFGDYESTYQ 20 Y WQ AN+ I +RDLD FVSAT L + +S Y+ Sbjct: 134 YLWQKANAEIWQRDLDPFVSATTLLSE-DSRYR 165