BLASTX nr result
ID: Cornus23_contig00044735
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00044735 (317 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010048048.1| PREDICTED: TMV resistance protein N-like [Eu... 58 2e-06 gb|KCW80148.1| hypothetical protein EUGRSUZ_C01492 [Eucalyptus g... 58 2e-06 ref|XP_002513078.1| leucine-rich repeat-containing protein, puta... 57 7e-06 ref|XP_010050646.1| PREDICTED: protein SUPPRESSOR OF npr1-1, CON... 56 9e-06 gb|KCW85118.1| hypothetical protein EUGRSUZ_B01960 [Eucalyptus g... 56 9e-06 >ref|XP_010048048.1| PREDICTED: TMV resistance protein N-like [Eucalyptus grandis] Length = 1092 Score = 58.2 bits (139), Expect = 2e-06 Identities = 36/104 (34%), Positives = 53/104 (50%), Gaps = 4/104 (3%) Frame = -2 Query: 304 KISHLPMSICGLCDLQTLDLFGCRKXXXXXXXXXXXXXXSVT----CRVMEAFSCLPNLT 137 K++H+P SI L LQ L+L GC +M+ + + NL Sbjct: 807 KLAHIPNSIGNLASLQWLELEGCYSLTEIPDSIGNLASLIKLDLRKSSIMKLPNSIGNLA 866 Query: 136 SLKKLHLEECWNLVEVPRAIGKLSELETLALRQTGIRTVPEEIG 5 SL++L LE C +L E+P +IG L+ L L LR++ I +PE IG Sbjct: 867 SLQRLELEGCCSLTEIPDSIGNLASLIKLDLRKSSIMKLPESIG 910 >gb|KCW80148.1| hypothetical protein EUGRSUZ_C01492 [Eucalyptus grandis] Length = 552 Score = 58.2 bits (139), Expect = 2e-06 Identities = 36/104 (34%), Positives = 53/104 (50%), Gaps = 4/104 (3%) Frame = -2 Query: 304 KISHLPMSICGLCDLQTLDLFGCRKXXXXXXXXXXXXXXSVT----CRVMEAFSCLPNLT 137 K++H+P SI L LQ L+L GC +M+ + + NL Sbjct: 267 KLAHIPNSIGNLASLQWLELEGCYSLTEIPDSIGNLASLIKLDLRKSSIMKLPNSIGNLA 326 Query: 136 SLKKLHLEECWNLVEVPRAIGKLSELETLALRQTGIRTVPEEIG 5 SL++L LE C +L E+P +IG L+ L L LR++ I +PE IG Sbjct: 327 SLQRLELEGCCSLTEIPDSIGNLASLIKLDLRKSSIMKLPESIG 370 >ref|XP_002513078.1| leucine-rich repeat-containing protein, putative [Ricinus communis] gi|223548089|gb|EEF49581.1| leucine-rich repeat-containing protein, putative [Ricinus communis] Length = 1096 Score = 56.6 bits (135), Expect = 7e-06 Identities = 32/89 (35%), Positives = 45/89 (50%) Frame = -2 Query: 316 LNLTKISHLPMSICGLCDLQTLDLFGCRKXXXXXXXXXXXXXXSVTCRVMEAFSCLPNLT 137 L+ T+I LP SIC LC+LQTL L GC K + C +L Sbjct: 598 LSYTEIKELPDSICNLCNLQTLILVGCNK-------------------FLTLPKCTKDLV 638 Query: 136 SLKKLHLEECWNLVEVPRAIGKLSELETL 50 +L+ L+L CW+L +P + GKL+ L+ L Sbjct: 639 NLRHLNLTGCWHLKSMPPSFGKLTSLQRL 667 >ref|XP_010050646.1| PREDICTED: protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1-like [Eucalyptus grandis] Length = 1229 Score = 56.2 bits (134), Expect = 9e-06 Identities = 42/109 (38%), Positives = 55/109 (50%), Gaps = 5/109 (4%) Frame = -2 Query: 316 LNLTKISHLPMSICGLCDLQTLDLFGCRKXXXXXXXXXXXXXXS-VTCRVMEAFSCLPN- 143 L T I+ LP SI L +L+TLD C S + R + LPN Sbjct: 902 LKFTMIAKLPESISSLKELRTLDASYCTLLTYLPNSIGHLESLSFLDLRFCRKLAQLPNT 961 Query: 142 ---LTSLKKLHLEECWNLVEVPRAIGKLSELETLALRQTGIRTVPEEIG 5 L SL++L LEEC +L E+P +IGKL+ L L L+ T I +PE IG Sbjct: 962 IGSLASLQRLLLEECRSLREIPNSIGKLAWLTELNLKHTAIVELPESIG 1010 >gb|KCW85118.1| hypothetical protein EUGRSUZ_B01960 [Eucalyptus grandis] Length = 440 Score = 56.2 bits (134), Expect = 9e-06 Identities = 34/102 (33%), Positives = 53/102 (51%), Gaps = 1/102 (0%) Frame = -2 Query: 307 TKISHLPMSICGLCDLQTLDLFGCRKXXXXXXXXXXXXXXSVTCRVMEAFSCLPNLTSLK 128 + ++ +P SI L L+ LDL+ C+ + E S + NL+SLK Sbjct: 210 SSLTEIPSSIENLSSLEQLDLWSCKS-------------------LTEIPSSIGNLSSLK 250 Query: 127 KLHLEECWNLVEVPRAIGKLSELETLALRQ-TGIRTVPEEIG 5 +LHL+ C L+E+P +IG LS L+ L LR ++ +P IG Sbjct: 251 QLHLQSCELLIEIPSSIGNLSSLKQLHLRSCESLKEIPSSIG 292