BLASTX nr result
ID: Cornus23_contig00044708
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00044708 (280 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011096416.1| PREDICTED: pentatricopeptide repeat-containi... 69 1e-09 ref|XP_010686330.1| PREDICTED: pentatricopeptide repeat-containi... 67 5e-09 ref|XP_010277732.1| PREDICTED: pentatricopeptide repeat-containi... 67 7e-09 ref|XP_012857628.1| PREDICTED: pentatricopeptide repeat-containi... 66 9e-09 ref|XP_012850998.1| PREDICTED: pentatricopeptide repeat-containi... 66 9e-09 ref|XP_012841163.1| PREDICTED: pentatricopeptide repeat-containi... 66 9e-09 gb|EYU34251.1| hypothetical protein MIMGU_mgv1a023919mg, partial... 66 9e-09 gb|EYU26028.1| hypothetical protein MIMGU_mgv1a020221mg, partial... 66 9e-09 gb|EYU24803.1| hypothetical protein MIMGU_mgv1a005461mg [Erythra... 66 9e-09 gb|EYU20554.1| hypothetical protein MIMGU_mgv1a024283mg [Erythra... 66 9e-09 gb|EYU28058.1| hypothetical protein MIMGU_mgv1a023407mg [Erythra... 65 2e-08 ref|XP_006353201.1| PREDICTED: pentatricopeptide repeat-containi... 65 2e-08 ref|XP_012835573.1| PREDICTED: pentatricopeptide repeat-containi... 64 4e-08 ref|XP_010312638.1| PREDICTED: pentatricopeptide repeat-containi... 64 4e-08 gb|EYU38928.1| hypothetical protein MIMGU_mgv1a026074mg, partial... 64 4e-08 ref|XP_009615722.1| PREDICTED: pentatricopeptide repeat-containi... 60 6e-07 ref|XP_008812854.1| PREDICTED: pentatricopeptide repeat-containi... 60 8e-07 ref|XP_010927941.1| PREDICTED: pentatricopeptide repeat-containi... 59 1e-06 ref|XP_009793694.1| PREDICTED: pentatricopeptide repeat-containi... 59 1e-06 gb|KNA15574.1| hypothetical protein SOVF_097160 [Spinacia oleracea] 58 2e-06 >ref|XP_011096416.1| PREDICTED: pentatricopeptide repeat-containing protein At1g28690, mitochondrial [Sesamum indicum] Length = 529 Score = 69.3 bits (168), Expect = 1e-09 Identities = 29/41 (70%), Positives = 36/41 (87%) Frame = -3 Query: 275 RWDSVNEVRESMKVRGIAKDTGFSWVGTDGGLKGFHAGQKI 153 RWDSV+++RE MKVRGI+K TGF+WVGTD GL+ FHAGQ + Sbjct: 489 RWDSVSQLRELMKVRGISKGTGFTWVGTDAGLEAFHAGQSL 529 >ref|XP_010686330.1| PREDICTED: pentatricopeptide repeat-containing protein At1g28690, mitochondrial [Beta vulgaris subsp. vulgaris] gi|731350095|ref|XP_010686331.1| PREDICTED: pentatricopeptide repeat-containing protein At1g28690, mitochondrial [Beta vulgaris subsp. vulgaris] gi|870852615|gb|KMT04530.1| hypothetical protein BVRB_8g181920 [Beta vulgaris subsp. vulgaris] Length = 540 Score = 67.0 bits (162), Expect = 5e-09 Identities = 30/38 (78%), Positives = 32/38 (84%) Frame = -3 Query: 275 RWDSVNEVRESMKVRGIAKDTGFSWVGTDGGLKGFHAG 162 +WDSVNEVRE MK RGI+KDTGFSW GTD LK FHAG Sbjct: 500 KWDSVNEVRELMKWRGISKDTGFSWTGTDNRLKHFHAG 537 >ref|XP_010277732.1| PREDICTED: pentatricopeptide repeat-containing protein At1g28690, mitochondrial [Nelumbo nucifera] Length = 541 Score = 66.6 bits (161), Expect = 7e-09 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = -3 Query: 275 RWDSVNEVRESMKVRGIAKDTGFSWVGTDGGLKGFHAGQKI 153 +WD V+EVRE MK RG++KDTG SWVGTD GL GFH GQ + Sbjct: 501 KWDGVSEVREMMKERGVSKDTGRSWVGTDSGLCGFHVGQNV 541 >ref|XP_012857628.1| PREDICTED: pentatricopeptide repeat-containing protein At1g28690, mitochondrial-like [Erythranthe guttatus] Length = 527 Score = 66.2 bits (160), Expect = 9e-09 Identities = 26/41 (63%), Positives = 35/41 (85%) Frame = -3 Query: 275 RWDSVNEVRESMKVRGIAKDTGFSWVGTDGGLKGFHAGQKI 153 +WDSV+++RE MK RGI+K TGF+W+GTD GL+ FHAGQ + Sbjct: 487 KWDSVSQLRELMKARGISKGTGFTWIGTDAGLEAFHAGQSL 527 >ref|XP_012850998.1| PREDICTED: pentatricopeptide repeat-containing protein At1g28690, mitochondrial-like [Erythranthe guttatus] Length = 524 Score = 66.2 bits (160), Expect = 9e-09 Identities = 26/41 (63%), Positives = 35/41 (85%) Frame = -3 Query: 275 RWDSVNEVRESMKVRGIAKDTGFSWVGTDGGLKGFHAGQKI 153 +WDSV+++RE MK RGI+K TGF+W+GTD GL+ FHAGQ + Sbjct: 484 KWDSVSQLRELMKARGISKGTGFTWIGTDAGLEAFHAGQSL 524 >ref|XP_012841163.1| PREDICTED: pentatricopeptide repeat-containing protein At1g28690, mitochondrial-like [Erythranthe guttatus] gi|848881629|ref|XP_012841164.1| PREDICTED: pentatricopeptide repeat-containing protein At1g28690, mitochondrial-like [Erythranthe guttatus] Length = 527 Score = 66.2 bits (160), Expect = 9e-09 Identities = 26/41 (63%), Positives = 35/41 (85%) Frame = -3 Query: 275 RWDSVNEVRESMKVRGIAKDTGFSWVGTDGGLKGFHAGQKI 153 +WDSV+++RE MK RGI+K TGF+W+GTD GL+ FHAGQ + Sbjct: 487 KWDSVSQLRELMKARGISKGTGFTWIGTDAGLEAFHAGQSL 527 >gb|EYU34251.1| hypothetical protein MIMGU_mgv1a023919mg, partial [Erythranthe guttata] Length = 504 Score = 66.2 bits (160), Expect = 9e-09 Identities = 26/41 (63%), Positives = 35/41 (85%) Frame = -3 Query: 275 RWDSVNEVRESMKVRGIAKDTGFSWVGTDGGLKGFHAGQKI 153 +WDSV+++RE MK RGI+K TGF+W+GTD GL+ FHAGQ + Sbjct: 464 KWDSVSQLRELMKARGISKGTGFTWIGTDAGLEAFHAGQSL 504 >gb|EYU26028.1| hypothetical protein MIMGU_mgv1a020221mg, partial [Erythranthe guttata] Length = 492 Score = 66.2 bits (160), Expect = 9e-09 Identities = 26/41 (63%), Positives = 35/41 (85%) Frame = -3 Query: 275 RWDSVNEVRESMKVRGIAKDTGFSWVGTDGGLKGFHAGQKI 153 +WDSV+++RE MK RGI+K TGF+W+GTD GL+ FHAGQ + Sbjct: 452 KWDSVSQLRELMKARGISKGTGFTWIGTDAGLEAFHAGQSL 492 >gb|EYU24803.1| hypothetical protein MIMGU_mgv1a005461mg [Erythranthe guttata] Length = 483 Score = 66.2 bits (160), Expect = 9e-09 Identities = 26/41 (63%), Positives = 35/41 (85%) Frame = -3 Query: 275 RWDSVNEVRESMKVRGIAKDTGFSWVGTDGGLKGFHAGQKI 153 +WDSV+++RE MK RGI+K TGF+W+GTD GL+ FHAGQ + Sbjct: 443 KWDSVSQLRELMKARGISKGTGFTWIGTDAGLEAFHAGQSL 483 >gb|EYU20554.1| hypothetical protein MIMGU_mgv1a024283mg [Erythranthe guttata] Length = 510 Score = 66.2 bits (160), Expect = 9e-09 Identities = 26/41 (63%), Positives = 35/41 (85%) Frame = -3 Query: 275 RWDSVNEVRESMKVRGIAKDTGFSWVGTDGGLKGFHAGQKI 153 +WDSV+++RE MK RGI+K TGF+W+GTD GL+ FHAGQ + Sbjct: 470 KWDSVSQLRELMKARGISKGTGFTWIGTDAGLEAFHAGQSL 510 >gb|EYU28058.1| hypothetical protein MIMGU_mgv1a023407mg [Erythranthe guttata] Length = 515 Score = 65.1 bits (157), Expect = 2e-08 Identities = 25/41 (60%), Positives = 35/41 (85%) Frame = -3 Query: 275 RWDSVNEVRESMKVRGIAKDTGFSWVGTDGGLKGFHAGQKI 153 +WDSV+++RE MK RG++K TGF+W+GTD GL+ FHAGQ + Sbjct: 475 KWDSVSQLRELMKARGMSKGTGFTWIGTDAGLEAFHAGQSL 515 >ref|XP_006353201.1| PREDICTED: pentatricopeptide repeat-containing protein At1g28690, mitochondrial-like [Solanum tuberosum] Length = 527 Score = 65.1 bits (157), Expect = 2e-08 Identities = 28/40 (70%), Positives = 34/40 (85%) Frame = -3 Query: 275 RWDSVNEVRESMKVRGIAKDTGFSWVGTDGGLKGFHAGQK 156 RWD V+E+RE MK+RGI+K TGFSWVG+DG LK F AGQ+ Sbjct: 487 RWDGVSELREIMKIRGISKGTGFSWVGSDGSLKAFLAGQQ 526 >ref|XP_012835573.1| PREDICTED: pentatricopeptide repeat-containing protein At1g28690, mitochondrial-like [Erythranthe guttatus] Length = 527 Score = 63.9 bits (154), Expect = 4e-08 Identities = 25/41 (60%), Positives = 34/41 (82%) Frame = -3 Query: 275 RWDSVNEVRESMKVRGIAKDTGFSWVGTDGGLKGFHAGQKI 153 +WDSV+++RE MK RGI+K TG +W+GTD GL+ FHAGQ + Sbjct: 487 KWDSVSQLRELMKARGISKGTGLTWIGTDAGLEAFHAGQSL 527 >ref|XP_010312638.1| PREDICTED: pentatricopeptide repeat-containing protein At1g28690, mitochondrial [Solanum lycopersicum] Length = 575 Score = 63.9 bits (154), Expect = 4e-08 Identities = 27/40 (67%), Positives = 33/40 (82%) Frame = -3 Query: 275 RWDSVNEVRESMKVRGIAKDTGFSWVGTDGGLKGFHAGQK 156 RWD V+E+RE MK+RGI+K TGFSWVG+DG L F AGQ+ Sbjct: 535 RWDGVSELREIMKIRGISKGTGFSWVGSDGSLNAFFAGQQ 574 >gb|EYU38928.1| hypothetical protein MIMGU_mgv1a026074mg, partial [Erythranthe guttata] Length = 504 Score = 63.9 bits (154), Expect = 4e-08 Identities = 25/41 (60%), Positives = 34/41 (82%) Frame = -3 Query: 275 RWDSVNEVRESMKVRGIAKDTGFSWVGTDGGLKGFHAGQKI 153 +WDSV+++RE MK RGI+K TG +W+GTD GL+ FHAGQ + Sbjct: 464 KWDSVSQLRELMKARGISKGTGLTWIGTDAGLEAFHAGQSL 504 >ref|XP_009615722.1| PREDICTED: pentatricopeptide repeat-containing protein At1g28690, mitochondrial [Nicotiana tomentosiformis] Length = 527 Score = 60.1 bits (144), Expect = 6e-07 Identities = 27/41 (65%), Positives = 31/41 (75%) Frame = -3 Query: 275 RWDSVNEVRESMKVRGIAKDTGFSWVGTDGGLKGFHAGQKI 153 RWD V+E+RE MK+RGI+K TGFSWVG D LK F A Q I Sbjct: 487 RWDGVSELREIMKIRGISKGTGFSWVGGDSSLKAFFAEQHI 527 >ref|XP_008812854.1| PREDICTED: pentatricopeptide repeat-containing protein At1g28690, mitochondrial [Phoenix dactylifera] gi|672185563|ref|XP_008812855.1| PREDICTED: pentatricopeptide repeat-containing protein At1g28690, mitochondrial [Phoenix dactylifera] Length = 530 Score = 59.7 bits (143), Expect = 8e-07 Identities = 26/41 (63%), Positives = 32/41 (78%) Frame = -3 Query: 275 RWDSVNEVRESMKVRGIAKDTGFSWVGTDGGLKGFHAGQKI 153 +W+ V +VRE MK RG++KDTG SWVGTD GL GFH G+ I Sbjct: 490 KWEGVCQVRELMKERGVSKDTGRSWVGTDKGLCGFHVGELI 530 >ref|XP_010927941.1| PREDICTED: pentatricopeptide repeat-containing protein At1g28690, mitochondrial [Elaeis guineensis] Length = 530 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/41 (60%), Positives = 32/41 (78%) Frame = -3 Query: 275 RWDSVNEVRESMKVRGIAKDTGFSWVGTDGGLKGFHAGQKI 153 +W+ V +VRE MK +G++KDTG SWVGTD GL GFH G+ I Sbjct: 490 KWEGVCQVRELMKEKGVSKDTGRSWVGTDKGLCGFHVGEPI 530 >ref|XP_009793694.1| PREDICTED: pentatricopeptide repeat-containing protein At1g28690, mitochondrial [Nicotiana sylvestris] Length = 526 Score = 58.9 bits (141), Expect = 1e-06 Identities = 27/41 (65%), Positives = 33/41 (80%) Frame = -3 Query: 275 RWDSVNEVRESMKVRGIAKDTGFSWVGTDGGLKGFHAGQKI 153 RWD V+E+RE MK+RGI+K TGFSWVG+D LK F GQ+I Sbjct: 487 RWDGVSELREIMKIRGISKGTGFSWVGSDSSLKAF-LGQQI 526 >gb|KNA15574.1| hypothetical protein SOVF_097160 [Spinacia oleracea] Length = 539 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/38 (68%), Positives = 29/38 (76%) Frame = -3 Query: 275 RWDSVNEVRESMKVRGIAKDTGFSWVGTDGGLKGFHAG 162 +WDS N+VRE MK RGI+KDTG SW GT GLK F AG Sbjct: 500 KWDSANKVRELMKRRGISKDTGLSWTGTKDGLKRFDAG 537