BLASTX nr result
ID: Cornus23_contig00044593
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00044593 (289 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007831975.1| hypothetical protein PFICI_05203 [Pestalotio... 66 7e-09 dbj|GAP82569.1| putative rna recognition domain-containing prote... 66 7e-09 ref|XP_007789730.1| putative rnp domain-containing protein [Euty... 66 7e-09 emb|CEJ80402.1| Putative RNP domain protein [Torrubiella hemipte... 65 2e-08 ref|XP_014577446.1| RNP domain protein, partial [Metarhizium maj... 65 2e-08 ref|XP_014549902.1| RNP domain protein, partial [Metarhizium bru... 65 2e-08 gb|KDB13184.1| RNP domain protein [Ustilaginoidea virens] 65 2e-08 ref|XP_007817427.1| RNA recognition motif domain protein [Metarh... 65 2e-08 gb|KOS21374.1| Single-stranded TG1-3 DNA-binding protein [Escovo... 65 2e-08 gb|KPM42427.1| hypothetical protein AK830_g4130 [Neonectria diti... 65 3e-08 emb|CRJ93856.1| hypothetical protein BN1708_009425 [Verticillium... 63 5e-08 ref|XP_003346612.1| hypothetical protein SMAC_04785 [Sordaria ma... 63 5e-08 emb|CRK41385.1| hypothetical protein BN1708_001760 [Verticillium... 63 5e-08 ref|XP_007600034.1| RNA recognition domain-containing protein [C... 63 5e-08 gb|KDN67547.1| putative RNA recognition domain-containing protei... 63 5e-08 ref|XP_008091724.1| RNA recognition domain-containing protein [C... 63 5e-08 ref|XP_003009051.1| RNP domain-containing protein [Verticillium ... 63 5e-08 emb|CCF46366.1| RNP domain-containing protein, partial [Colletot... 63 6e-08 emb|CRK43714.1| hypothetical protein BN1723_019266, partial [Ver... 63 6e-08 emb|CRK18643.1| hypothetical protein BN1708_017688, partial [Ver... 63 6e-08 >ref|XP_007831975.1| hypothetical protein PFICI_05203 [Pestalotiopsis fici W106-1] gi|573063676|gb|ETS83327.1| hypothetical protein PFICI_05203 [Pestalotiopsis fici W106-1] Length = 361 Score = 66.2 bits (160), Expect(2) = 7e-09 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = -3 Query: 269 RRLVTEMNGKEIEGREIAVKVAIDSPDKTDEEANI 165 ++ VTEMNGKEIEGREIAVKVAIDSPDKTDEEANI Sbjct: 306 QKAVTEMNGKEIEGREIAVKVAIDSPDKTDEEANI 340 Score = 20.4 bits (41), Expect(2) = 7e-09 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 288 ASEELQQKA 262 ASEELQQKA Sbjct: 300 ASEELQQKA 308 >dbj|GAP82569.1| putative rna recognition domain-containing protein [Rosellinia necatrix] Length = 352 Score = 66.2 bits (160), Expect(2) = 7e-09 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = -3 Query: 269 RRLVTEMNGKEIEGREIAVKVAIDSPDKTDEEANI 165 ++ VTEMNGKEIEGREIAVKVAIDSPDKTDEEANI Sbjct: 300 QKAVTEMNGKEIEGREIAVKVAIDSPDKTDEEANI 334 Score = 20.4 bits (41), Expect(2) = 7e-09 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 288 ASEELQQKA 262 ASEELQQKA Sbjct: 294 ASEELQQKA 302 >ref|XP_007789730.1| putative rnp domain-containing protein [Eutypa lata UCREL1] gi|471572860|gb|EMR71175.1| putative rnp domain-containing protein [Eutypa lata UCREL1] Length = 347 Score = 66.2 bits (160), Expect(2) = 7e-09 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = -3 Query: 269 RRLVTEMNGKEIEGREIAVKVAIDSPDKTDEEANI 165 ++ VTEMNGKEIEGREIAVKVAIDSPDKTDEEANI Sbjct: 295 QKAVTEMNGKEIEGREIAVKVAIDSPDKTDEEANI 329 Score = 20.4 bits (41), Expect(2) = 7e-09 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 288 ASEELQQKA 262 ASEELQQKA Sbjct: 289 ASEELQQKA 297 >emb|CEJ80402.1| Putative RNP domain protein [Torrubiella hemipterigena] Length = 369 Score = 64.7 bits (156), Expect(2) = 2e-08 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -3 Query: 269 RRLVTEMNGKEIEGREIAVKVAIDSPDKTDEEAN 168 ++ VTEMNGKEIEGREIAVKVAIDSPDKTDEEAN Sbjct: 315 QKAVTEMNGKEIEGREIAVKVAIDSPDKTDEEAN 348 Score = 20.4 bits (41), Expect(2) = 2e-08 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 288 ASEELQQKA 262 ASEELQQKA Sbjct: 309 ASEELQQKA 317 >ref|XP_014577446.1| RNP domain protein, partial [Metarhizium majus ARSEF 297] gi|743658161|gb|KID85480.1| RNP domain protein [Metarhizium guizhouense ARSEF 977] gi|743671517|gb|KID98452.1| RNP domain protein, partial [Metarhizium majus ARSEF 297] Length = 363 Score = 64.7 bits (156), Expect(2) = 2e-08 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -3 Query: 269 RRLVTEMNGKEIEGREIAVKVAIDSPDKTDEEAN 168 ++ VTEMNGKEIEGREIAVKVAIDSPDKTDEEAN Sbjct: 313 QKAVTEMNGKEIEGREIAVKVAIDSPDKTDEEAN 346 Score = 20.4 bits (41), Expect(2) = 2e-08 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 288 ASEELQQKA 262 ASEELQQKA Sbjct: 307 ASEELQQKA 315 >ref|XP_014549902.1| RNP domain protein, partial [Metarhizium brunneum ARSEF 3297] gi|594717959|gb|EXV00854.1| RNA recognition motif (RRM) superfamily protein [Metarhizium robertsii] gi|743634160|gb|KID65548.1| RNP domain protein, partial [Metarhizium anisopliae ARSEF 549] gi|743649738|gb|KID80764.1| RNP domain protein, partial [Metarhizium brunneum ARSEF 3297] gi|770397594|gb|KJK83564.1| hypothetical protein H634G_01693 [Metarhizium anisopliae BRIP 53293] gi|770402623|gb|KJK87655.1| hypothetical protein H633G_08483 [Metarhizium anisopliae BRIP 53284] Length = 363 Score = 64.7 bits (156), Expect(2) = 2e-08 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -3 Query: 269 RRLVTEMNGKEIEGREIAVKVAIDSPDKTDEEAN 168 ++ VTEMNGKEIEGREIAVKVAIDSPDKTDEEAN Sbjct: 313 QKAVTEMNGKEIEGREIAVKVAIDSPDKTDEEAN 346 Score = 20.4 bits (41), Expect(2) = 2e-08 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 288 ASEELQQKA 262 ASEELQQKA Sbjct: 307 ASEELQQKA 315 >gb|KDB13184.1| RNP domain protein [Ustilaginoidea virens] Length = 359 Score = 64.7 bits (156), Expect(2) = 2e-08 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -3 Query: 269 RRLVTEMNGKEIEGREIAVKVAIDSPDKTDEEAN 168 ++ VTEMNGKEIEGREIAVKVAIDSPDKTDEEAN Sbjct: 308 QKAVTEMNGKEIEGREIAVKVAIDSPDKTDEEAN 341 Score = 20.4 bits (41), Expect(2) = 2e-08 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 288 ASEELQQKA 262 ASEELQQKA Sbjct: 302 ASEELQQKA 310 >ref|XP_007817427.1| RNA recognition motif domain protein [Metarhizium robertsii ARSEF 23] gi|322712591|gb|EFZ04164.1| RNA recognition motif domain protein [Metarhizium robertsii ARSEF 23] gi|672385794|gb|KFG87880.1| glycine-rich protein [Metarhizium anisopliae] Length = 343 Score = 64.7 bits (156), Expect(2) = 2e-08 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -3 Query: 269 RRLVTEMNGKEIEGREIAVKVAIDSPDKTDEEAN 168 ++ VTEMNGKEIEGREIAVKVAIDSPDKTDEEAN Sbjct: 293 QKAVTEMNGKEIEGREIAVKVAIDSPDKTDEEAN 326 Score = 20.4 bits (41), Expect(2) = 2e-08 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 288 ASEELQQKA 262 ASEELQQKA Sbjct: 287 ASEELQQKA 295 >gb|KOS21374.1| Single-stranded TG1-3 DNA-binding protein [Escovopsis weberi] Length = 363 Score = 65.1 bits (157), Expect = 2e-08 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = -3 Query: 275 CSRRLVTEMNGKEIEGREIAVKVAIDSPDKTDEEA 171 C +R V EMNGKEIEGREIAVKVAIDSPDKTDEEA Sbjct: 308 CQQRAVAEMNGKEIEGREIAVKVAIDSPDKTDEEA 342 >gb|KPM42427.1| hypothetical protein AK830_g4130 [Neonectria ditissima] Length = 389 Score = 64.7 bits (156), Expect = 3e-08 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -3 Query: 269 RRLVTEMNGKEIEGREIAVKVAIDSPDKTDEEAN 168 ++ VTEMNGKEIEGREIAVKVAIDSPDKTDEEAN Sbjct: 317 QKAVTEMNGKEIEGREIAVKVAIDSPDKTDEEAN 350 >emb|CRJ93856.1| hypothetical protein BN1708_009425 [Verticillium longisporum] Length = 846 Score = 63.2 bits (152), Expect(2) = 5e-08 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = -3 Query: 269 RRLVTEMNGKEIEGREIAVKVAIDSPDKTDEEAN 168 ++ V+EMNGKEIEGREIAVKVAIDSPDKTDEEAN Sbjct: 301 QKAVSEMNGKEIEGREIAVKVAIDSPDKTDEEAN 334 Score = 20.4 bits (41), Expect(2) = 5e-08 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 288 ASEELQQKA 262 ASEELQQKA Sbjct: 295 ASEELQQKA 303 >ref|XP_003346612.1| hypothetical protein SMAC_04785 [Sordaria macrospora k-hell] gi|380090507|emb|CCC11803.1| unnamed protein product [Sordaria macrospora k-hell] Length = 390 Score = 63.2 bits (152), Expect(2) = 5e-08 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = -3 Query: 269 RRLVTEMNGKEIEGREIAVKVAIDSPDKTDEEAN 168 ++ V+EMNGKEIEGREIAVKVAIDSPDKTDEEAN Sbjct: 298 QKAVSEMNGKEIEGREIAVKVAIDSPDKTDEEAN 331 Score = 20.4 bits (41), Expect(2) = 5e-08 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 288 ASEELQQKA 262 ASEELQQKA Sbjct: 292 ASEELQQKA 300 >emb|CRK41385.1| hypothetical protein BN1708_001760 [Verticillium longisporum] Length = 381 Score = 63.2 bits (152), Expect(2) = 5e-08 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = -3 Query: 269 RRLVTEMNGKEIEGREIAVKVAIDSPDKTDEEAN 168 ++ V+EMNGKEIEGREIAVKVAIDSPDKTDEEAN Sbjct: 301 QKAVSEMNGKEIEGREIAVKVAIDSPDKTDEEAN 334 Score = 20.4 bits (41), Expect(2) = 5e-08 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 288 ASEELQQKA 262 ASEELQQKA Sbjct: 295 ASEELQQKA 303 >ref|XP_007600034.1| RNA recognition domain-containing protein [Colletotrichum fioriniae PJ7] gi|588894264|gb|EXF76273.1| RNA recognition domain-containing protein [Colletotrichum fioriniae PJ7] Length = 371 Score = 63.2 bits (152), Expect(2) = 5e-08 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = -3 Query: 269 RRLVTEMNGKEIEGREIAVKVAIDSPDKTDEEAN 168 ++ V+EMNGKEIEGREIAVKVAIDSPDKTDEEAN Sbjct: 302 QKAVSEMNGKEIEGREIAVKVAIDSPDKTDEEAN 335 Score = 20.4 bits (41), Expect(2) = 5e-08 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 288 ASEELQQKA 262 ASEELQQKA Sbjct: 296 ASEELQQKA 304 >gb|KDN67547.1| putative RNA recognition domain-containing protein [Colletotrichum sublineola] Length = 369 Score = 63.2 bits (152), Expect(2) = 5e-08 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = -3 Query: 269 RRLVTEMNGKEIEGREIAVKVAIDSPDKTDEEAN 168 ++ V+EMNGKEIEGREIAVKVAIDSPDKTDEEAN Sbjct: 299 QKAVSEMNGKEIEGREIAVKVAIDSPDKTDEEAN 332 Score = 20.4 bits (41), Expect(2) = 5e-08 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 288 ASEELQQKA 262 ASEELQQKA Sbjct: 293 ASEELQQKA 301 >ref|XP_008091724.1| RNA recognition domain-containing protein [Colletotrichum graminicola M1.001] gi|310792177|gb|EFQ27704.1| RNA recognition domain-containing protein [Colletotrichum graminicola M1.001] Length = 367 Score = 63.2 bits (152), Expect(2) = 5e-08 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = -3 Query: 269 RRLVTEMNGKEIEGREIAVKVAIDSPDKTDEEAN 168 ++ V+EMNGKEIEGREIAVKVAIDSPDKTDEEAN Sbjct: 299 QKAVSEMNGKEIEGREIAVKVAIDSPDKTDEEAN 332 Score = 20.4 bits (41), Expect(2) = 5e-08 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 288 ASEELQQKA 262 ASEELQQKA Sbjct: 293 ASEELQQKA 301 >ref|XP_003009051.1| RNP domain-containing protein [Verticillium alfalfae VaMs.102] gi|261352197|gb|EEY14625.1| RNP domain-containing protein [Verticillium alfalfae VaMs.102] Length = 300 Score = 63.2 bits (152), Expect(2) = 5e-08 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = -3 Query: 269 RRLVTEMNGKEIEGREIAVKVAIDSPDKTDEEAN 168 ++ V+EMNGKEIEGREIAVKVAIDSPDKTDEEAN Sbjct: 220 QKAVSEMNGKEIEGREIAVKVAIDSPDKTDEEAN 253 Score = 20.4 bits (41), Expect(2) = 5e-08 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 288 ASEELQQKA 262 ASEELQQKA Sbjct: 214 ASEELQQKA 222 >emb|CCF46366.1| RNP domain-containing protein, partial [Colletotrichum higginsianum] Length = 204 Score = 63.2 bits (152), Expect(2) = 6e-08 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = -3 Query: 269 RRLVTEMNGKEIEGREIAVKVAIDSPDKTDEEAN 168 ++ V+EMNGKEIEGREIAVKVAIDSPDKTDEEAN Sbjct: 129 QKAVSEMNGKEIEGREIAVKVAIDSPDKTDEEAN 162 Score = 20.4 bits (41), Expect(2) = 6e-08 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 288 ASEELQQKA 262 ASEELQQKA Sbjct: 123 ASEELQQKA 131 >emb|CRK43714.1| hypothetical protein BN1723_019266, partial [Verticillium longisporum] Length = 100 Score = 63.2 bits (152), Expect(2) = 6e-08 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = -3 Query: 269 RRLVTEMNGKEIEGREIAVKVAIDSPDKTDEEAN 168 ++ V+EMNGKEIEGREIAVKVAIDSPDKTDEEAN Sbjct: 20 QKAVSEMNGKEIEGREIAVKVAIDSPDKTDEEAN 53 Score = 20.4 bits (41), Expect(2) = 6e-08 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 288 ASEELQQKA 262 ASEELQQKA Sbjct: 14 ASEELQQKA 22 >emb|CRK18643.1| hypothetical protein BN1708_017688, partial [Verticillium longisporum] Length = 100 Score = 63.2 bits (152), Expect(2) = 6e-08 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = -3 Query: 269 RRLVTEMNGKEIEGREIAVKVAIDSPDKTDEEAN 168 ++ V+EMNGKEIEGREIAVKVAIDSPDKTDEEAN Sbjct: 20 QKAVSEMNGKEIEGREIAVKVAIDSPDKTDEEAN 53 Score = 20.4 bits (41), Expect(2) = 6e-08 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -2 Query: 288 ASEELQQKA 262 ASEELQQKA Sbjct: 14 ASEELQQKA 22