BLASTX nr result
ID: Cornus23_contig00044540
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00044540 (391 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KEQ85203.1| hypothetical protein M438DRAFT_354306 [Aureobasid... 64 6e-08 >gb|KEQ85203.1| hypothetical protein M438DRAFT_354306 [Aureobasidium pullulans EXF-150] Length = 218 Score = 63.5 bits (153), Expect = 6e-08 Identities = 33/57 (57%), Positives = 37/57 (64%) Frame = -1 Query: 172 SVNANFDDLTGLPGSIVNPIPAPYKGLDYVGIDFTTVINTGTNLQPGIAPESQPNYA 2 S NANFDDLT LP ++P+P PYKGL + DF TVI TG L PG P S NYA Sbjct: 30 SQNANFDDLTALPLVNLSPVPTPYKGLYFQAFDFATVIQTG--LLPGPVPHSGSNYA 84