BLASTX nr result
ID: Cornus23_contig00044369
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00044369 (366 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001794863.1| hypothetical protein SNOG_04446 [Parastagono... 74 6e-11 ref|XP_014081305.1| hypothetical protein COCC4DRAFT_131984 [Bipo... 57 4e-06 ref|XP_007689018.1| hypothetical protein COCMIDRAFT_6248 [Bipola... 57 4e-06 >ref|XP_001794863.1| hypothetical protein SNOG_04446 [Parastagonospora nodorum SN15] gi|160706281|gb|EAT88206.2| hypothetical protein SNOG_04446 [Parastagonospora nodorum SN15] Length = 248 Score = 73.6 bits (179), Expect = 6e-11 Identities = 31/42 (73%), Positives = 36/42 (85%) Frame = -1 Query: 366 GPNAGGSANAEPHVLSGDNEMAEDGNTAFGYTVHNGNGSADY 241 GPN GG AN+E HVLSGD+EMAEDG+ FGYTVHNGNG+ +Y Sbjct: 207 GPNPGGPANSEQHVLSGDSEMAEDGSNTFGYTVHNGNGNGEY 248 >ref|XP_014081305.1| hypothetical protein COCC4DRAFT_131984 [Bipolaris maydis ATCC 48331] gi|452001848|gb|EMD94307.1| hypothetical protein COCHEDRAFT_1211728 [Bipolaris maydis C5] gi|477590322|gb|ENI07396.1| hypothetical protein COCC4DRAFT_131984 [Bipolaris maydis ATCC 48331] Length = 189 Score = 57.4 bits (137), Expect = 4e-06 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = -1 Query: 366 GPNAGGSANAEPHVLSGDNEMAEDGNTAFGYTVHNGNGS 250 GPNAGGS N + HVLSGD+EM +D +TAFGY VHNGNG+ Sbjct: 151 GPNAGGSENQQ-HVLSGDSEMGDD-STAFGYPVHNGNGT 187 >ref|XP_007689018.1| hypothetical protein COCMIDRAFT_6248 [Bipolaris oryzae ATCC 44560] gi|628073717|ref|XP_007701512.1| hypothetical protein COCSADRAFT_172706 [Bipolaris sorokiniana ND90Pr] gi|628196024|ref|XP_007709723.1| hypothetical protein COCCADRAFT_89386 [Bipolaris zeicola 26-R-13] gi|953421449|ref|XP_014552796.1| hypothetical protein COCVIDRAFT_41089 [Bipolaris victoriae FI3] gi|451850025|gb|EMD63328.1| hypothetical protein COCSADRAFT_172706 [Bipolaris sorokiniana ND90Pr] gi|576921845|gb|EUC35980.1| hypothetical protein COCCADRAFT_89386 [Bipolaris zeicola 26-R-13] gi|576930890|gb|EUC44462.1| hypothetical protein COCMIDRAFT_6248 [Bipolaris oryzae ATCC 44560] gi|578485729|gb|EUN23219.1| hypothetical protein COCVIDRAFT_41089 [Bipolaris victoriae FI3] Length = 189 Score = 57.4 bits (137), Expect = 4e-06 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = -1 Query: 366 GPNAGGSANAEPHVLSGDNEMAEDGNTAFGYTVHNGNGS 250 GPNAGGS N + HVLSGD+EM +D +TAFGY VHNGNG+ Sbjct: 151 GPNAGGSENQQ-HVLSGDSEMGDD-STAFGYPVHNGNGT 187