BLASTX nr result
ID: Cornus23_contig00044363
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00044363 (280 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO75681.1| hypothetical protein CISIN_1g038377mg [Citrus sin... 64 6e-08 ref|XP_006467915.1| PREDICTED: uncharacterized protein LOC102608... 64 6e-08 ref|XP_006467914.1| PREDICTED: uncharacterized protein LOC102608... 64 6e-08 ref|XP_006449193.1| hypothetical protein CICLE_v10018309mg [Citr... 64 6e-08 ref|XP_012091474.1| PREDICTED: lysine-specific demethylase JMJ25... 63 1e-07 ref|XP_012091471.1| PREDICTED: lysine-specific demethylase JMJ25... 63 1e-07 ref|XP_010646369.1| PREDICTED: uncharacterized protein LOC100266... 59 2e-06 emb|CBI40868.3| unnamed protein product [Vitis vinifera] 59 2e-06 emb|CAN59730.1| hypothetical protein VITISV_042729 [Vitis vinifera] 58 2e-06 >gb|KDO75681.1| hypothetical protein CISIN_1g038377mg [Citrus sinensis] Length = 979 Score = 63.5 bits (153), Expect = 6e-08 Identities = 37/52 (71%), Positives = 38/52 (73%) Frame = -1 Query: 280 QNLEIRARKREKVSKTTKAPKRNRTIDVSEALDEALKKMKLKRGDLQLELIR 125 Q EIRARK SK K K+ R I SEALDEALKKMKLKRGDLQLELIR Sbjct: 68 QRTEIRARK----SKKLKRKKKKRVIGESEALDEALKKMKLKRGDLQLELIR 115 >ref|XP_006467915.1| PREDICTED: uncharacterized protein LOC102608274 isoform X2 [Citrus sinensis] Length = 1003 Score = 63.5 bits (153), Expect = 6e-08 Identities = 37/52 (71%), Positives = 38/52 (73%) Frame = -1 Query: 280 QNLEIRARKREKVSKTTKAPKRNRTIDVSEALDEALKKMKLKRGDLQLELIR 125 Q EIRARK SK K K+ R I SEALDEALKKMKLKRGDLQLELIR Sbjct: 68 QRTEIRARK----SKKLKRKKKKRVIGESEALDEALKKMKLKRGDLQLELIR 115 >ref|XP_006467914.1| PREDICTED: uncharacterized protein LOC102608274 isoform X1 [Citrus sinensis] Length = 1004 Score = 63.5 bits (153), Expect = 6e-08 Identities = 37/52 (71%), Positives = 38/52 (73%) Frame = -1 Query: 280 QNLEIRARKREKVSKTTKAPKRNRTIDVSEALDEALKKMKLKRGDLQLELIR 125 Q EIRARK SK K K+ R I SEALDEALKKMKLKRGDLQLELIR Sbjct: 68 QRTEIRARK----SKKLKRKKKKRVIGESEALDEALKKMKLKRGDLQLELIR 115 >ref|XP_006449193.1| hypothetical protein CICLE_v10018309mg [Citrus clementina] gi|557551804|gb|ESR62433.1| hypothetical protein CICLE_v10018309mg [Citrus clementina] Length = 886 Score = 63.5 bits (153), Expect = 6e-08 Identities = 37/52 (71%), Positives = 38/52 (73%) Frame = -1 Query: 280 QNLEIRARKREKVSKTTKAPKRNRTIDVSEALDEALKKMKLKRGDLQLELIR 125 Q EIRARK SK K K+ R I SEALDEALKKMKLKRGDLQLELIR Sbjct: 68 QRTEIRARK----SKKLKRKKKKRVIGESEALDEALKKMKLKRGDLQLELIR 115 >ref|XP_012091474.1| PREDICTED: lysine-specific demethylase JMJ25 isoform X2 [Jatropha curcas] Length = 1031 Score = 62.8 bits (151), Expect = 1e-07 Identities = 36/54 (66%), Positives = 41/54 (75%), Gaps = 3/54 (5%) Frame = -1 Query: 277 NLEIRARKREKVS---KTTKAPKRNRTIDVSEALDEALKKMKLKRGDLQLELIR 125 N EIRA K EK+S K K KR ++I SEALDEA+KKM+LKRGDLQLELIR Sbjct: 74 NGEIRAHKGEKLSRLVKLAKPMKRKKSIGESEALDEAVKKMRLKRGDLQLELIR 127 >ref|XP_012091471.1| PREDICTED: lysine-specific demethylase JMJ25 isoform X1 [Jatropha curcas] gi|643703806|gb|KDP20870.1| hypothetical protein JCGZ_21341 [Jatropha curcas] Length = 1040 Score = 62.8 bits (151), Expect = 1e-07 Identities = 36/54 (66%), Positives = 41/54 (75%), Gaps = 3/54 (5%) Frame = -1 Query: 277 NLEIRARKREKVS---KTTKAPKRNRTIDVSEALDEALKKMKLKRGDLQLELIR 125 N EIRA K EK+S K K KR ++I SEALDEA+KKM+LKRGDLQLELIR Sbjct: 74 NGEIRAHKGEKLSRLVKLAKPMKRKKSIGESEALDEAVKKMRLKRGDLQLELIR 127 >ref|XP_010646369.1| PREDICTED: uncharacterized protein LOC100266659 [Vitis vinifera] Length = 866 Score = 58.5 bits (140), Expect = 2e-06 Identities = 32/52 (61%), Positives = 41/52 (78%) Frame = -1 Query: 280 QNLEIRARKREKVSKTTKAPKRNRTIDVSEALDEALKKMKLKRGDLQLELIR 125 +N EIRA++ K++K K R ++ VSEALD+ALKKMKLK+GDLQLELIR Sbjct: 72 RNPEIRAKRAAKLAKPMK---RRGSVRVSEALDKALKKMKLKKGDLQLELIR 120 >emb|CBI40868.3| unnamed protein product [Vitis vinifera] Length = 420 Score = 58.5 bits (140), Expect = 2e-06 Identities = 32/52 (61%), Positives = 41/52 (78%) Frame = -1 Query: 280 QNLEIRARKREKVSKTTKAPKRNRTIDVSEALDEALKKMKLKRGDLQLELIR 125 +N EIRA++ K++K K R ++ VSEALD+ALKKMKLK+GDLQLELIR Sbjct: 72 RNPEIRAKRAAKLAKPMK---RRGSVRVSEALDKALKKMKLKKGDLQLELIR 120 >emb|CAN59730.1| hypothetical protein VITISV_042729 [Vitis vinifera] Length = 1266 Score = 58.2 bits (139), Expect = 2e-06 Identities = 32/52 (61%), Positives = 41/52 (78%) Frame = -1 Query: 280 QNLEIRARKREKVSKTTKAPKRNRTIDVSEALDEALKKMKLKRGDLQLELIR 125 +N EIRA++ K++K K R ++ VSEALD+ALKKMKLK+GDLQLELIR Sbjct: 159 RNPEIRAKRAVKLAKPMK---RRGSVRVSEALDKALKKMKLKKGDLQLELIR 207