BLASTX nr result
ID: Cornus23_contig00044158
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00044158 (319 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KMZ67894.1| Cysteine proteinase cathepsin F [Zostera marina] 58 2e-06 >gb|KMZ67894.1| Cysteine proteinase cathepsin F [Zostera marina] Length = 351 Score = 58.2 bits (139), Expect = 2e-06 Identities = 32/84 (38%), Positives = 49/84 (58%), Gaps = 1/84 (1%) Frame = -2 Query: 249 WAAYVNKYALSYSP-EEYSFRQGVYEANLVRAAKLQLENPLAEFGETIFSHLTQLEFETT 73 + A++NKY YS +EYS+R V+ N ++AA+ Q+ +P A G T FS LT EFE + Sbjct: 40 FTAFINKYGKKYSSRKEYSYRLTVFVKNTLKAAQNQILDPTAVHGTTPFSDLTMEEFERS 99 Query: 72 YLGSNTDFKLYNGKETNFSSYSLP 1 + G T + N +E+ + LP Sbjct: 100 FTGLLTRNNIMNSEESMMETKGLP 123