BLASTX nr result
ID: Cornus23_contig00044120
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00044120 (319 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010070467.1| PREDICTED: BTB/POZ domain-containing protein... 80 6e-13 ref|XP_011016336.1| PREDICTED: BTB/POZ domain-containing protein... 80 8e-13 ref|XP_004301873.1| PREDICTED: BTB/POZ domain-containing protein... 80 8e-13 ref|XP_010680961.1| PREDICTED: BTB/POZ domain-containing protein... 79 1e-12 ref|XP_009771239.1| PREDICTED: BTB/POZ domain-containing protein... 79 1e-12 ref|XP_011099250.1| PREDICTED: BTB/POZ domain-containing protein... 79 2e-12 ref|XP_011025673.1| PREDICTED: BTB/POZ domain-containing protein... 79 2e-12 ref|XP_012852790.1| PREDICTED: BTB/POZ domain-containing protein... 79 2e-12 ref|XP_014510066.1| PREDICTED: BTB/POZ domain-containing protein... 78 2e-12 gb|KRH69996.1| hypothetical protein GLYMA_02G061400 [Glycine max] 78 2e-12 gb|KOM25594.1| hypothetical protein LR48_Vigan123s001400 [Vigna ... 78 2e-12 gb|KHN13354.1| BTB/POZ domain-containing protein [Glycine soja] 78 2e-12 ref|XP_013446439.1| phototropic-responsive NPH3 family protein [... 78 2e-12 ref|XP_008241595.1| PREDICTED: BTB/POZ domain-containing protein... 78 2e-12 ref|XP_002522384.1| protein binding protein, putative [Ricinus c... 78 2e-12 ref|XP_007155991.1| hypothetical protein PHAVU_003G249600g [Phas... 78 2e-12 ref|XP_007203853.1| hypothetical protein PRUPE_ppa002346mg [Prun... 78 2e-12 ref|XP_003548908.1| PREDICTED: BTB/POZ domain-containing protein... 78 2e-12 ref|XP_003518074.1| PREDICTED: BTB/POZ domain-containing protein... 78 2e-12 ref|XP_013446437.1| phototropic-responsive NPH3 family protein [... 78 2e-12 >ref|XP_010070467.1| PREDICTED: BTB/POZ domain-containing protein At5g66560 [Eucalyptus grandis] gi|629093266|gb|KCW59261.1| hypothetical protein EUGRSUZ_H01939 [Eucalyptus grandis] Length = 704 Score = 80.1 bits (196), Expect = 6e-13 Identities = 34/39 (87%), Positives = 38/39 (97%) Frame = +3 Query: 201 TNSKGQAWFCTTGLPSDVVIEVEDMNFHLHKFPLMSKSR 317 T+SKGQAWFCTTGLPSD+V+EV+DM FHLHKFPLMSKSR Sbjct: 6 TSSKGQAWFCTTGLPSDIVVEVDDMTFHLHKFPLMSKSR 44 >ref|XP_011016336.1| PREDICTED: BTB/POZ domain-containing protein At5g66560-like [Populus euphratica] gi|743943654|ref|XP_011016337.1| PREDICTED: BTB/POZ domain-containing protein At5g66560-like [Populus euphratica] Length = 662 Score = 79.7 bits (195), Expect = 8e-13 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = +3 Query: 204 NSKGQAWFCTTGLPSDVVIEVEDMNFHLHKFPLMSKSR 317 +SKGQAWFCTTGLPSD+VIEVEDM FHLHKFPLMSKSR Sbjct: 7 SSKGQAWFCTTGLPSDIVIEVEDMTFHLHKFPLMSKSR 44 >ref|XP_004301873.1| PREDICTED: BTB/POZ domain-containing protein At5g66560 [Fragaria vesca subsp. vesca] Length = 671 Score = 79.7 bits (195), Expect = 8e-13 Identities = 34/39 (87%), Positives = 38/39 (97%) Frame = +3 Query: 201 TNSKGQAWFCTTGLPSDVVIEVEDMNFHLHKFPLMSKSR 317 ++SKGQAWFCTTGLPSD+V+EVEDM FHLHKFPLMSKSR Sbjct: 10 SSSKGQAWFCTTGLPSDIVVEVEDMTFHLHKFPLMSKSR 48 >ref|XP_010680961.1| PREDICTED: BTB/POZ domain-containing protein At5g66560-like [Beta vulgaris subsp. vulgaris] gi|870856972|gb|KMT08548.1| hypothetical protein BVRB_6g138290 [Beta vulgaris subsp. vulgaris] Length = 645 Score = 79.0 bits (193), Expect = 1e-12 Identities = 34/41 (82%), Positives = 39/41 (95%) Frame = +3 Query: 195 MATNSKGQAWFCTTGLPSDVVIEVEDMNFHLHKFPLMSKSR 317 M+T SKGQAWFCTTGLPSDVV+EV++M FHLHKFPLMSKS+ Sbjct: 8 MSTPSKGQAWFCTTGLPSDVVVEVDEMTFHLHKFPLMSKSK 48 >ref|XP_009771239.1| PREDICTED: BTB/POZ domain-containing protein At5g66560 [Nicotiana sylvestris] Length = 655 Score = 79.0 bits (193), Expect = 1e-12 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = +3 Query: 207 SKGQAWFCTTGLPSDVVIEVEDMNFHLHKFPLMSKSR 317 SKGQAWFCTTGLPSD++IEVEDM FHLHKFPLMSKSR Sbjct: 9 SKGQAWFCTTGLPSDIIIEVEDMTFHLHKFPLMSKSR 45 >ref|XP_011099250.1| PREDICTED: BTB/POZ domain-containing protein At5g66560 [Sesamum indicum] Length = 668 Score = 78.6 bits (192), Expect = 2e-12 Identities = 34/38 (89%), Positives = 37/38 (97%) Frame = +3 Query: 204 NSKGQAWFCTTGLPSDVVIEVEDMNFHLHKFPLMSKSR 317 +SKGQAWFCTTGLPSDV+IEV+DM FHLHKFPLMSKSR Sbjct: 7 SSKGQAWFCTTGLPSDVIIEVDDMTFHLHKFPLMSKSR 44 >ref|XP_011025673.1| PREDICTED: BTB/POZ domain-containing protein At5g66560-like [Populus euphratica] Length = 656 Score = 78.6 bits (192), Expect = 2e-12 Identities = 34/38 (89%), Positives = 37/38 (97%) Frame = +3 Query: 204 NSKGQAWFCTTGLPSDVVIEVEDMNFHLHKFPLMSKSR 317 +SKGQAWFCTTGLPSD+VIEVEDM FHLHKFPLMSKS+ Sbjct: 7 SSKGQAWFCTTGLPSDIVIEVEDMTFHLHKFPLMSKSK 44 >ref|XP_012852790.1| PREDICTED: BTB/POZ domain-containing protein At5g66560 [Erythranthe guttatus] gi|604345831|gb|EYU44328.1| hypothetical protein MIMGU_mgv1a002439mg [Erythranthe guttata] Length = 675 Score = 78.6 bits (192), Expect = 2e-12 Identities = 34/38 (89%), Positives = 37/38 (97%) Frame = +3 Query: 204 NSKGQAWFCTTGLPSDVVIEVEDMNFHLHKFPLMSKSR 317 +SKGQAWFCTTGLPSDV+IEV+DM FHLHKFPLMSKSR Sbjct: 12 SSKGQAWFCTTGLPSDVIIEVDDMTFHLHKFPLMSKSR 49 >ref|XP_014510066.1| PREDICTED: BTB/POZ domain-containing protein At5g66560 isoform X1 [Vigna radiata var. radiata] Length = 658 Score = 78.2 bits (191), Expect = 2e-12 Identities = 33/38 (86%), Positives = 37/38 (97%) Frame = +3 Query: 204 NSKGQAWFCTTGLPSDVVIEVEDMNFHLHKFPLMSKSR 317 +SKGQAWFCTTGLPSD+V+EV+DM FHLHKFPLMSKSR Sbjct: 8 SSKGQAWFCTTGLPSDIVVEVDDMTFHLHKFPLMSKSR 45 >gb|KRH69996.1| hypothetical protein GLYMA_02G061400 [Glycine max] Length = 660 Score = 78.2 bits (191), Expect = 2e-12 Identities = 33/38 (86%), Positives = 37/38 (97%) Frame = +3 Query: 204 NSKGQAWFCTTGLPSDVVIEVEDMNFHLHKFPLMSKSR 317 +SKGQAWFCTTGLPSD+V+EV+DM FHLHKFPLMSKSR Sbjct: 8 SSKGQAWFCTTGLPSDIVVEVDDMTFHLHKFPLMSKSR 45 >gb|KOM25594.1| hypothetical protein LR48_Vigan123s001400 [Vigna angularis] Length = 654 Score = 78.2 bits (191), Expect = 2e-12 Identities = 33/38 (86%), Positives = 37/38 (97%) Frame = +3 Query: 204 NSKGQAWFCTTGLPSDVVIEVEDMNFHLHKFPLMSKSR 317 +SKGQAWFCTTGLPSD+V+EV+DM FHLHKFPLMSKSR Sbjct: 8 SSKGQAWFCTTGLPSDIVVEVDDMTFHLHKFPLMSKSR 45 >gb|KHN13354.1| BTB/POZ domain-containing protein [Glycine soja] Length = 616 Score = 78.2 bits (191), Expect = 2e-12 Identities = 33/38 (86%), Positives = 37/38 (97%) Frame = +3 Query: 204 NSKGQAWFCTTGLPSDVVIEVEDMNFHLHKFPLMSKSR 317 +SKGQAWFCTTGLPSD+V+EV+DM FHLHKFPLMSKSR Sbjct: 8 SSKGQAWFCTTGLPSDIVVEVDDMTFHLHKFPLMSKSR 45 >ref|XP_013446439.1| phototropic-responsive NPH3 family protein [Medicago truncatula] gi|657375043|gb|KEH20466.1| phototropic-responsive NPH3 family protein [Medicago truncatula] Length = 464 Score = 78.2 bits (191), Expect = 2e-12 Identities = 33/38 (86%), Positives = 37/38 (97%) Frame = +3 Query: 204 NSKGQAWFCTTGLPSDVVIEVEDMNFHLHKFPLMSKSR 317 +SKGQAWFCTTGLPSD+V+EV+DM FHLHKFPLMSKSR Sbjct: 8 SSKGQAWFCTTGLPSDIVVEVDDMTFHLHKFPLMSKSR 45 >ref|XP_008241595.1| PREDICTED: BTB/POZ domain-containing protein At5g66560 [Prunus mume] Length = 685 Score = 78.2 bits (191), Expect = 2e-12 Identities = 33/38 (86%), Positives = 37/38 (97%) Frame = +3 Query: 204 NSKGQAWFCTTGLPSDVVIEVEDMNFHLHKFPLMSKSR 317 +SKGQAWFCTTGLPSD+V+EV+DM FHLHKFPLMSKSR Sbjct: 12 SSKGQAWFCTTGLPSDIVVEVDDMTFHLHKFPLMSKSR 49 >ref|XP_002522384.1| protein binding protein, putative [Ricinus communis] gi|223538462|gb|EEF40068.1| protein binding protein, putative [Ricinus communis] Length = 646 Score = 78.2 bits (191), Expect = 2e-12 Identities = 33/38 (86%), Positives = 37/38 (97%) Frame = +3 Query: 204 NSKGQAWFCTTGLPSDVVIEVEDMNFHLHKFPLMSKSR 317 +S+GQAWFCTTGLPSD++IEVEDM FHLHKFPLMSKSR Sbjct: 7 SSRGQAWFCTTGLPSDIIIEVEDMTFHLHKFPLMSKSR 44 >ref|XP_007155991.1| hypothetical protein PHAVU_003G249600g [Phaseolus vulgaris] gi|593785903|ref|XP_007155992.1| hypothetical protein PHAVU_003G249600g [Phaseolus vulgaris] gi|561029345|gb|ESW27985.1| hypothetical protein PHAVU_003G249600g [Phaseolus vulgaris] gi|561029346|gb|ESW27986.1| hypothetical protein PHAVU_003G249600g [Phaseolus vulgaris] Length = 649 Score = 78.2 bits (191), Expect = 2e-12 Identities = 33/38 (86%), Positives = 37/38 (97%) Frame = +3 Query: 204 NSKGQAWFCTTGLPSDVVIEVEDMNFHLHKFPLMSKSR 317 +SKGQAWFCTTGLPSD+V+EV+DM FHLHKFPLMSKSR Sbjct: 8 SSKGQAWFCTTGLPSDIVVEVDDMTFHLHKFPLMSKSR 45 >ref|XP_007203853.1| hypothetical protein PRUPE_ppa002346mg [Prunus persica] gi|462399384|gb|EMJ05052.1| hypothetical protein PRUPE_ppa002346mg [Prunus persica] Length = 684 Score = 78.2 bits (191), Expect = 2e-12 Identities = 33/38 (86%), Positives = 37/38 (97%) Frame = +3 Query: 204 NSKGQAWFCTTGLPSDVVIEVEDMNFHLHKFPLMSKSR 317 +SKGQAWFCTTGLPSD+V+EV+DM FHLHKFPLMSKSR Sbjct: 12 SSKGQAWFCTTGLPSDIVVEVDDMTFHLHKFPLMSKSR 49 >ref|XP_003548908.1| PREDICTED: BTB/POZ domain-containing protein At5g66560-like [Glycine max] gi|947058944|gb|KRH08350.1| hypothetical protein GLYMA_16G143800 [Glycine max] gi|947058945|gb|KRH08351.1| hypothetical protein GLYMA_16G143800 [Glycine max] gi|947058946|gb|KRH08352.1| hypothetical protein GLYMA_16G143800 [Glycine max] Length = 648 Score = 78.2 bits (191), Expect = 2e-12 Identities = 33/38 (86%), Positives = 37/38 (97%) Frame = +3 Query: 204 NSKGQAWFCTTGLPSDVVIEVEDMNFHLHKFPLMSKSR 317 +SKGQAWFCTTGLPSD+V+EV+DM FHLHKFPLMSKSR Sbjct: 8 SSKGQAWFCTTGLPSDIVVEVDDMTFHLHKFPLMSKSR 45 >ref|XP_003518074.1| PREDICTED: BTB/POZ domain-containing protein At5g66560-like [Glycine max] gi|947121791|gb|KRH69997.1| hypothetical protein GLYMA_02G061400 [Glycine max] gi|947121792|gb|KRH69998.1| hypothetical protein GLYMA_02G061400 [Glycine max] Length = 655 Score = 78.2 bits (191), Expect = 2e-12 Identities = 33/38 (86%), Positives = 37/38 (97%) Frame = +3 Query: 204 NSKGQAWFCTTGLPSDVVIEVEDMNFHLHKFPLMSKSR 317 +SKGQAWFCTTGLPSD+V+EV+DM FHLHKFPLMSKSR Sbjct: 8 SSKGQAWFCTTGLPSDIVVEVDDMTFHLHKFPLMSKSR 45 >ref|XP_013446437.1| phototropic-responsive NPH3 family protein [Medicago truncatula] gi|657375041|gb|KEH20464.1| phototropic-responsive NPH3 family protein [Medicago truncatula] Length = 661 Score = 78.2 bits (191), Expect = 2e-12 Identities = 33/38 (86%), Positives = 37/38 (97%) Frame = +3 Query: 204 NSKGQAWFCTTGLPSDVVIEVEDMNFHLHKFPLMSKSR 317 +SKGQAWFCTTGLPSD+V+EV+DM FHLHKFPLMSKSR Sbjct: 8 SSKGQAWFCTTGLPSDIVVEVDDMTFHLHKFPLMSKSR 45