BLASTX nr result
ID: Cornus23_contig00044072
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00044072 (315 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007840374.1| hypothetical protein PFICI_13602 [Pestalotio... 110 3e-22 >ref|XP_007840374.1| hypothetical protein PFICI_13602 [Pestalotiopsis fici W106-1] gi|573055183|gb|ETS75118.1| hypothetical protein PFICI_13602 [Pestalotiopsis fici W106-1] Length = 79 Score = 110 bits (276), Expect = 3e-22 Identities = 50/73 (68%), Positives = 65/73 (89%), Gaps = 2/73 (2%) Frame = -2 Query: 257 MSE--EDLSLKKRITNTILPDEAQAGSAMTHGAGHGNKTGEFRSDSIRGKTMEGLGKVIQ 84 MSE E+LSLKKR+TN I+PD+ +AGSAMTHG GHGNKTGE+R DS+RG+ MEG+GK++ Sbjct: 1 MSEQPENLSLKKRVTNPIVPDKPRAGSAMTHGTGHGNKTGEYRRDSLRGQAMEGIGKLVH 60 Query: 83 NKGLQEKGHELRR 45 N+GLQ++GHE+RR Sbjct: 61 NQGLQDRGHEMRR 73