BLASTX nr result
ID: Cornus23_contig00044045
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00044045 (293 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHJ33023.1| putative f-box domain-containing protein [Erysiph... 59 1e-06 >gb|KHJ33023.1| putative f-box domain-containing protein [Erysiphe necator] Length = 504 Score = 58.9 bits (141), Expect = 1e-06 Identities = 27/43 (62%), Positives = 33/43 (76%) Frame = -1 Query: 281 WSGAGNDVRKSVIIGNGAQGFMNIPGLPGEIGRPVSSAGERMR 153 W GAG+DVRKSVIIGNG GF+ IPG GE RP++S +R+R Sbjct: 451 WKGAGHDVRKSVIIGNGFGGFLAIPGEGGEARRPLTSGSDRVR 493