BLASTX nr result
ID: Cornus23_contig00043976
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00043976 (344 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003844524.1| hypothetical protein LEMA_P021750.1 [Leptosp... 77 5e-12 ref|XP_007686273.1| hypothetical protein COCMIDRAFT_90763 [Bipol... 74 4e-11 ref|XP_014076478.1| hypothetical protein COCC4DRAFT_144958 [Bipo... 74 4e-11 ref|XP_007697290.1| hypothetical protein COCSADRAFT_158063 [Bipo... 74 6e-11 ref|XP_008023144.1| hypothetical protein SETTUDRAFT_105175 [Seto... 70 5e-10 gb|KNG48342.1| hypothetical protein TW65_04864 [Stemphylium lyco... 70 8e-10 ref|XP_001799718.1| hypothetical protein SNOG_09424 [Parastagono... 68 3e-09 ref|XP_001931332.1| conserved hypothetical protein [Pyrenophora ... 65 2e-08 >ref|XP_003844524.1| hypothetical protein LEMA_P021750.1 [Leptosphaeria maculans JN3] gi|312221104|emb|CBY01045.1| hypothetical protein LEMA_P021750.1 [Leptosphaeria maculans JN3] Length = 147 Score = 77.0 bits (188), Expect = 5e-12 Identities = 32/41 (78%), Positives = 38/41 (92%) Frame = -2 Query: 343 SERYVRQYRQQDGYISFPDFEKFCESESPYEQHREQTAVKT 221 SERYVRQYR+QDGYISFPDFEKFC++E+PY+QH + AVKT Sbjct: 107 SERYVRQYRKQDGYISFPDFEKFCQTENPYDQHNQNNAVKT 147 >ref|XP_007686273.1| hypothetical protein COCMIDRAFT_90763 [Bipolaris oryzae ATCC 44560] gi|628187003|ref|XP_007707650.1| hypothetical protein COCCADRAFT_83775 [Bipolaris zeicola 26-R-13] gi|953435567|ref|XP_014559855.1| hypothetical protein COCVIDRAFT_13281 [Bipolaris victoriae FI3] gi|576923996|gb|EUC38109.1| hypothetical protein COCCADRAFT_83775 [Bipolaris zeicola 26-R-13] gi|576933701|gb|EUC47224.1| hypothetical protein COCMIDRAFT_90763 [Bipolaris oryzae ATCC 44560] gi|578492972|gb|EUN30368.1| hypothetical protein COCVIDRAFT_13281 [Bipolaris victoriae FI3] Length = 148 Score = 73.9 bits (180), Expect = 4e-11 Identities = 32/40 (80%), Positives = 36/40 (90%) Frame = -2 Query: 343 SERYVRQYRQQDGYISFPDFEKFCESESPYEQHREQTAVK 224 S+RYVRQYRQQDGYISFPDFEKFC++ESPY Q +QT VK Sbjct: 108 SDRYVRQYRQQDGYISFPDFEKFCQTESPYAQQEQQTDVK 147 >ref|XP_014076478.1| hypothetical protein COCC4DRAFT_144958 [Bipolaris maydis ATCC 48331] gi|451999485|gb|EMD91947.1| hypothetical protein COCHEDRAFT_1099217 [Bipolaris maydis C5] gi|477585481|gb|ENI02569.1| hypothetical protein COCC4DRAFT_144958 [Bipolaris maydis ATCC 48331] Length = 148 Score = 73.9 bits (180), Expect = 4e-11 Identities = 32/40 (80%), Positives = 36/40 (90%) Frame = -2 Query: 343 SERYVRQYRQQDGYISFPDFEKFCESESPYEQHREQTAVK 224 S+RYVRQYRQQDGYISFPDFEKFC++ESPY Q +QT VK Sbjct: 108 SDRYVRQYRQQDGYISFPDFEKFCQAESPYAQQEQQTDVK 147 >ref|XP_007697290.1| hypothetical protein COCSADRAFT_158063 [Bipolaris sorokiniana ND90Pr] gi|451854406|gb|EMD67699.1| hypothetical protein COCSADRAFT_158063 [Bipolaris sorokiniana ND90Pr] Length = 148 Score = 73.6 bits (179), Expect = 6e-11 Identities = 32/40 (80%), Positives = 36/40 (90%) Frame = -2 Query: 343 SERYVRQYRQQDGYISFPDFEKFCESESPYEQHREQTAVK 224 S+RYVRQYRQQDGYISFPDFEKFC++ESPY Q +QT VK Sbjct: 108 SDRYVRQYRQQDGYISFPDFEKFCQTESPYVQQEQQTDVK 147 >ref|XP_008023144.1| hypothetical protein SETTUDRAFT_105175 [Setosphaeria turcica Et28A] gi|482812626|gb|EOA89345.1| hypothetical protein SETTUDRAFT_105175 [Setosphaeria turcica Et28A] Length = 148 Score = 70.5 bits (171), Expect = 5e-10 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = -2 Query: 343 SERYVRQYRQQDGYISFPDFEKFCESESPYEQHREQTAVK 224 S+RYV QYRQQDGYISFPDFEKFC+SESPY Q +Q+ VK Sbjct: 108 SDRYVGQYRQQDGYISFPDFEKFCQSESPYGQQEQQSDVK 147 >gb|KNG48342.1| hypothetical protein TW65_04864 [Stemphylium lycopersici] Length = 148 Score = 69.7 bits (169), Expect = 8e-10 Identities = 29/41 (70%), Positives = 37/41 (90%) Frame = -2 Query: 343 SERYVRQYRQQDGYISFPDFEKFCESESPYEQHREQTAVKT 221 SERYVRQYR+QDGYISFPDFEKFC++E+PY+Q + + VK+ Sbjct: 108 SERYVRQYRKQDGYISFPDFEKFCQNENPYDQQDQHSDVKS 148 >ref|XP_001799718.1| hypothetical protein SNOG_09424 [Parastagonospora nodorum SN15] gi|111062496|gb|EAT83616.1| hypothetical protein SNOG_09424 [Parastagonospora nodorum SN15] Length = 154 Score = 67.8 bits (164), Expect = 3e-09 Identities = 29/41 (70%), Positives = 35/41 (85%) Frame = -2 Query: 343 SERYVRQYRQQDGYISFPDFEKFCESESPYEQHREQTAVKT 221 S+RYVRQ RQQDGYISFPDFEKFC++++ Y+Q REQ V T Sbjct: 114 SDRYVRQSRQQDGYISFPDFEKFCQTQNGYDQRREQNGVNT 154 >ref|XP_001931332.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|330944269|ref|XP_003306347.1| hypothetical protein PTT_19477 [Pyrenophora teres f. teres 0-1] gi|187972938|gb|EDU40437.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|311316197|gb|EFQ85580.1| hypothetical protein PTT_19477 [Pyrenophora teres f. teres 0-1] Length = 147 Score = 65.5 bits (158), Expect = 2e-08 Identities = 30/41 (73%), Positives = 36/41 (87%) Frame = -2 Query: 343 SERYVRQYRQQDGYISFPDFEKFCESESPYEQHREQTAVKT 221 S+RYVRQYRQQDGYISFPDFEKFC+++ Y Q +EQ+ VKT Sbjct: 108 SDRYVRQYRQQDGYISFPDFEKFCQNQDVYGQ-QEQSTVKT 147