BLASTX nr result
ID: Cornus23_contig00043842
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00043842 (311 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007923283.1| hypothetical protein MYCFIDRAFT_210323 [Pseu... 66 1e-08 gb|EME47506.1| hypothetical protein DOTSEDRAFT_69448 [Dothistrom... 60 5e-07 gb|EMF15847.1| hypothetical protein SEPMUDRAFT_147618 [Sphaeruli... 59 1e-06 ref|XP_007674312.1| hypothetical protein BAUCODRAFT_23066 [Baudo... 58 2e-06 >ref|XP_007923283.1| hypothetical protein MYCFIDRAFT_210323 [Pseudocercospora fijiensis CIRAD86] gi|452986035|gb|EME85791.1| hypothetical protein MYCFIDRAFT_210323 [Pseudocercospora fijiensis CIRAD86] Length = 214 Score = 65.9 bits (159), Expect = 1e-08 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = -1 Query: 311 FLGHKAGHGIIGGLVGAFLGSKGEDAWKDHNKHNKPH 201 FLGHKAGHGI+G L GAFLGSKGED WK+ HNKPH Sbjct: 177 FLGHKAGHGILGALAGAFLGSKGEDKWKE--SHNKPH 211 >gb|EME47506.1| hypothetical protein DOTSEDRAFT_69448 [Dothistroma septosporum NZE10] Length = 204 Score = 60.5 bits (145), Expect = 5e-07 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -1 Query: 308 LGHKAGHGIIGGLVGAFLGSKGEDAWKDHNKHNKP 204 LGHKAGHGIIG L GAFLGSKGED +K+H HNKP Sbjct: 162 LGHKAGHGIIGALAGAFLGSKGEDKFKEH--HNKP 194 >gb|EMF15847.1| hypothetical protein SEPMUDRAFT_147618 [Sphaerulina musiva SO2202] Length = 219 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 308 LGHKAGHGIIGGLVGAFLGSKGEDAWKDHNKHNKPH 201 LGHKAGHGIIG L GAFLGSKGED K + HNKPH Sbjct: 174 LGHKAGHGIIGALAGAFLGSKGEDKLKQKH-HNKPH 208 >ref|XP_007674312.1| hypothetical protein BAUCODRAFT_23066 [Baudoinia panamericana UAMH 10762] gi|449302253|gb|EMC98262.1| hypothetical protein BAUCODRAFT_23066 [Baudoinia panamericana UAMH 10762] Length = 229 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/39 (66%), Positives = 29/39 (74%), Gaps = 1/39 (2%) Frame = -1 Query: 311 FLGHK-AGHGIIGGLVGAFLGSKGEDAWKDHNKHNKPHQ 198 F GHK GHGIIG L GAF+GSK EDAWKDH +H + Q Sbjct: 159 FGGHKMGGHGIIGALAGAFMGSKAEDAWKDHRQHEQQQQ 197