BLASTX nr result
ID: Cornus23_contig00043644
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00043644 (333 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN68884.1| hypothetical protein VITISV_039230 [Vitis vinifera] 60 6e-07 gb|AAD32759.1| putative retroelement pol polyprotein [Arabidopsi... 56 9e-06 >emb|CAN68884.1| hypothetical protein VITISV_039230 [Vitis vinifera] Length = 220 Score = 60.1 bits (144), Expect = 6e-07 Identities = 24/62 (38%), Positives = 45/62 (72%) Frame = +3 Query: 3 TINIKATNGLLRTLTNVYHVPSVRRKVISLGAFISKGCWFEAKHGLIKVRRGPYIMLIGR 182 TI IK +G +RTLT+V HVP +++ +ISLG S GC ++A+ G++++ +G +++ G+ Sbjct: 112 TIRIKMYDGFIRTLTDVRHVPKLKKNLISLGTLDSNGCTYKAEGGVLRISKGALVVMKGK 171 Query: 183 RL 188 ++ Sbjct: 172 KI 173 >gb|AAD32759.1| putative retroelement pol polyprotein [Arabidopsis thaliana] Length = 1356 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/71 (35%), Positives = 46/71 (64%), Gaps = 1/71 (1%) Frame = +3 Query: 3 TINIKATNGLLRTLTNVYHVPSVRRKVISLGAFISKGCWFEAKHGLIKVRRGPYIMLIGR 182 TI +K ++GL LTNV ++P + R ++SLG F G FE++ G+++++ G ++L GR Sbjct: 352 TIRVKNSDGLTIVLTNVRYIPDMDRNLLSLGTFEKAGYKFESEDGILRIKAGNQVLLTGR 411 Query: 183 RL-VIFMSYWR 212 R +++ W+ Sbjct: 412 RYDTLYLLNWK 422