BLASTX nr result
ID: Cornus23_contig00043406
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00043406 (305 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN79410.1| hypothetical protein VITISV_038452 [Vitis vinifera] 44 6e-06 >emb|CAN79410.1| hypothetical protein VITISV_038452 [Vitis vinifera] Length = 256 Score = 43.5 bits (101), Expect(2) = 6e-06 Identities = 22/48 (45%), Positives = 28/48 (58%) Frame = -2 Query: 280 GGLGIKRLVLSNKALLRSGCGDLVWKRDRLWRRVIACRFGEVRGLMLS 137 GGLGI+ L NKALL C ++D LW++VI +FGE G S Sbjct: 30 GGLGIRNLSRLNKALLGKWCWRFASEQDSLWKQVIVRKFGEEEGCWCS 77 Score = 33.1 bits (74), Expect(2) = 6e-06 Identities = 14/34 (41%), Positives = 21/34 (61%) Frame = -3 Query: 144 CSLEVKIPEGVGVWRFIQIGWDELSKLIRFRVCD 43 CS + G+G+W+ I+ GW E SK + F+V D Sbjct: 76 CSGASRESHGMGLWKAIRNGWMEFSKRVAFKVGD 109