BLASTX nr result
ID: Cornus23_contig00043171
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00043171 (410 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006359087.1| PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma... 117 4e-24 ref|YP_005090371.1| ribosomal protein L2 (mitochondrion) [Phoeni... 103 4e-20 ref|YP_007905729.1| ribosomal protein L2 (mitochondrion) [Liriod... 103 5e-20 gb|AHA47111.1| ribosomal protein L2 (mitochondrion) [Amborella t... 94 5e-17 ref|YP_003433878.1| ribosomal protein large subunit 2 (mitochond... 90 7e-16 ref|YP_514664.1| ribosomal protein L2 (mitochondrion) [Oryza sat... 86 1e-14 sp|P92812.2|RM02_ORYSJ RecName: Full=60S ribosomal protein L2, m... 86 1e-14 emb|CAN61455.1| hypothetical protein VITISV_029794 [Vitis vinifera] 86 1e-14 emb|CDY71656.1| BnaUnng04510D [Brassica napus] 80 3e-14 gb|AEN56111.1| ribosomal protein L2 [Cucumis melo subsp. melo] 84 4e-14 ref|YP_008999589.1| ribosomal protein L2 (mitochondrion) [Vaccin... 82 1e-13 pir||S46947 ribosomal protein L2 - evening primrose mitochondrio... 82 2e-13 ref|YP_002608368.1| ribosomal protein L2 [Vitis vinifera] gi|209... 82 2e-13 gb|ALF04062.1| ribosomal protein L2 (mitochondrion) [Cannabis sa... 82 2e-13 ref|YP_173485.1| ribosomal protein L2 [Nicotiana tabacum] gi|756... 81 3e-13 ref|YP_009121961.1| ribosomal protein L2 (mitochondrion) [Hyoscy... 81 3e-13 ref|XP_010314947.1| PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma... 81 3e-13 ref|YP_009049780.1| ribosomal protein L2 (mitochondrion) [Capsic... 81 3e-13 gb|AIG89877.1| ribosomal protein L2 (mitochondrion) [Capsicum an... 81 3e-13 dbj|BAD83551.2| ribosomal protein L2 (mitochondrion) [Nicotiana ... 81 3e-13 >ref|XP_006359087.1| PREDICTED: LOW QUALITY PROTEIN: 60S ribosomal protein L2, mitochondrial-like [Solanum tuberosum] Length = 340 Score = 117 bits (292), Expect = 4e-24 Identities = 57/63 (90%), Positives = 58/63 (92%) Frame = -3 Query: 273 KFLGRAVRGSSRTVREPSPSTGA*VNTYIIASHQLEAGKMVMNCDWSKPSTSDLLRPAQN 94 KFLGRAVR SS TVREPSP GA VNTYIIASHQLEAGKMVMNCDWSKPSTSDLL+PAQN Sbjct: 277 KFLGRAVRDSSHTVREPSPCAGAXVNTYIIASHQLEAGKMVMNCDWSKPSTSDLLQPAQN 336 Query: 93 AHT 85 AHT Sbjct: 337 AHT 339 >ref|YP_005090371.1| ribosomal protein L2 (mitochondrion) [Phoenix dactylifera] gi|343478424|gb|AEM43912.1| ribosomal protein L2 (mitochondrion) [Phoenix dactylifera] Length = 558 Score = 103 bits (258), Expect = 4e-20 Identities = 54/69 (78%), Positives = 57/69 (82%), Gaps = 4/69 (5%) Frame = -3 Query: 201 VNTYIIASHQLEAGKMVMNCDWSKPSTSDLLRPAQNAHTY---*DLVHTAKKGRMEGGSK 31 VNTYI+ASHQLEAGKMVMNCDWSKPS S LRPAQNAHTY DLV TA KGR+EGGS+ Sbjct: 335 VNTYILASHQLEAGKMVMNCDWSKPSKSGFLRPAQNAHTYLRFQDLVRTANKGRVEGGSQ 394 Query: 30 LAAP-PLPP 7 LAA P PP Sbjct: 395 LAASWPRPP 403 >ref|YP_007905729.1| ribosomal protein L2 (mitochondrion) [Liriodendron tulipifera] gi|480541934|gb|AGJ90427.1| ribosomal protein L2 (mitochondrion) [Liriodendron tulipifera] Length = 554 Score = 103 bits (257), Expect = 5e-20 Identities = 54/69 (78%), Positives = 57/69 (82%), Gaps = 4/69 (5%) Frame = -3 Query: 195 TYIIASHQLEAGKMVMNCDWSKPSTSDLLRPAQNAHTY---*DLVHTAKKGRMEGGSKLA 25 TYI+ASHQLEAGKMVMNCDWSKPSTS LRPAQNAHTY DLV TA KGR+EGGS+LA Sbjct: 333 TYILASHQLEAGKMVMNCDWSKPSTSGFLRPAQNAHTYLRFQDLVRTANKGRVEGGSQLA 392 Query: 24 AP-PLPPLT 1 A P PP T Sbjct: 393 ASWPRPPST 401 >gb|AHA47111.1| ribosomal protein L2 (mitochondrion) [Amborella trichopoda] Length = 632 Score = 93.6 bits (231), Expect = 5e-17 Identities = 47/66 (71%), Positives = 50/66 (75%), Gaps = 3/66 (4%) Frame = -3 Query: 195 TYIIASHQLEAGKMVMNCDWSKPSTSDLLRPAQNAHTY---*DLVHTAKKGRMEGGSKLA 25 TYI+ASHQLE GKMVMNCDWSKPSTS LRPAQNAHTY DLV TA KGR G + A Sbjct: 414 TYILASHQLEVGKMVMNCDWSKPSTSGFLRPAQNAHTYLRFKDLVRTANKGREGGSQQAA 473 Query: 24 APPLPP 7 + P PP Sbjct: 474 SWPRPP 479 >ref|YP_003433878.1| ribosomal protein large subunit 2 (mitochondrion) [Oryza rufipogon] gi|285026149|dbj|BAI67982.1| ribosomal protein large subunit 2 (mitochondrion) [Oryza rufipogon] gi|285026205|dbj|BAI68037.1| ribosomal protein large subunit 2 (mitochondrion) [Oryza sativa Indica Group] Length = 504 Score = 89.7 bits (221), Expect = 7e-16 Identities = 48/69 (69%), Positives = 53/69 (76%), Gaps = 4/69 (5%) Frame = -3 Query: 201 VNTYIIASHQLEAGKMVMNCDWSKPSTSDLLRPAQNAHTY---*DLVHTAKKGRMEGGSK 31 VNTYI+ASHQLEAG MV+NCD SKPS S LRPAQNAHTY +L T KGR+EGGS+ Sbjct: 281 VNTYILASHQLEAGNMVINCDCSKPSKSGFLRPAQNAHTYLRFQELGRTVNKGRVEGGSQ 340 Query: 30 LAAP-PLPP 7 LAA P PP Sbjct: 341 LAASWPRPP 349 >ref|YP_514664.1| ribosomal protein L2 (mitochondrion) [Oryza sativa Indica Group] gi|194033244|ref|YP_002000581.1| ribosomal protein L2 (mitochondrion) [Oryza sativa Japonica Group] gi|23495405|dbj|BAC19886.1| Ribosomal protein L2 (mitochondrion) [Oryza sativa Japonica Group] gi|74100083|gb|AAZ99247.1| ribosomal protein L2 (mitochondrion) [Oryza sativa Indica Group] gi|74100138|gb|AAZ99301.1| ribosomal protein L2 (mitochondrion) [Oryza sativa Japonica Group] gi|74100192|gb|AAZ99354.1| ribosomal protein L2 (mitochondrion) [Oryza sativa Japonica Group] gi|353685231|gb|AER12994.1| ribosomal protein L2 (mitochondrion) [Oryza sativa Indica Group] gi|353685298|gb|AER13060.1| ribosomal protein L2 (mitochondrion) [Oryza sativa Indica Group] gi|374277621|gb|AEZ03727.1| ribosomal protein L2 (mitochondrion) [Oryza sativa Indica Group] gi|374277672|gb|AEZ03777.1| ribosomal protein L2 (mitochondrion) [Oryza sativa Indica Group] gi|528540449|dbj|BAN67503.1| ribosomal protein large subunit 2 (mitochondrion) [Oryza rufipogon] gi|528540486|dbj|BAN67539.1| ribosomal protein large subunit 2 (mitochondrion) [Oryza rufipogon] Length = 502 Score = 85.9 bits (211), Expect = 1e-14 Identities = 46/67 (68%), Positives = 51/67 (76%), Gaps = 4/67 (5%) Frame = -3 Query: 195 TYIIASHQLEAGKMVMNCDWSKPSTSDLLRPAQNAHTY---*DLVHTAKKGRMEGGSKLA 25 TYI+ASHQLEAG MV+NCD SKPS S LRPAQNAHTY +L T KGR+EGGS+LA Sbjct: 281 TYILASHQLEAGNMVINCDCSKPSKSGFLRPAQNAHTYLRFQELGRTVNKGRVEGGSQLA 340 Query: 24 AP-PLPP 7 A P PP Sbjct: 341 ASWPRPP 347 >sp|P92812.2|RM02_ORYSJ RecName: Full=60S ribosomal protein L2, mitochondrial gi|218547415|sp|P0C8K6.1|RM02_ORYSA RecName: Full=60S ribosomal protein L2, mitochondrial gi|218551750|sp|Q2F969.2|RM02_ORYSI RecName: Full=60S ribosomal protein L2, mitochondrial gi|193240423|dbj|BAA11350.2| ribosomal protein L2 (mitochondrion) [Oryza sativa Japonica Group] Length = 502 Score = 85.9 bits (211), Expect = 1e-14 Identities = 46/67 (68%), Positives = 51/67 (76%), Gaps = 4/67 (5%) Frame = -3 Query: 195 TYIIASHQLEAGKMVMNCDWSKPSTSDLLRPAQNAHTY---*DLVHTAKKGRMEGGSKLA 25 TYI+ASHQLEAG MV+NCD SKPS S LRPAQNAHTY +L T KGR+EGGS+LA Sbjct: 281 TYILASHQLEAGNMVINCDCSKPSKSGFLRPAQNAHTYLRFQELGRTVNKGRVEGGSQLA 340 Query: 24 AP-PLPP 7 A P PP Sbjct: 341 ASWPRPP 347 >emb|CAN61455.1| hypothetical protein VITISV_029794 [Vitis vinifera] Length = 336 Score = 85.9 bits (211), Expect = 1e-14 Identities = 39/40 (97%), Positives = 40/40 (100%) Frame = -3 Query: 201 VNTYIIASHQLEAGKMVMNCDWSKPSTSDLLRPAQNAHTY 82 VNTYIIASHQLEAGKMVMNCDWSKPSTSDLLRPA+NAHTY Sbjct: 297 VNTYIIASHQLEAGKMVMNCDWSKPSTSDLLRPARNAHTY 336 >emb|CDY71656.1| BnaUnng04510D [Brassica napus] Length = 104 Score = 79.7 bits (195), Expect(2) = 3e-14 Identities = 44/74 (59%), Positives = 46/74 (62%) Frame = -3 Query: 309 FI*NFYLERGGFKFLGRAVRGSSRTVREPSPSTGA*VNTYIIASHQLEAGKMVMNCDWSK 130 F+ F RGGFKFLGRAV NTYIIASHQLEAGKMVMNCDWSK Sbjct: 42 FLKKFDSWRGGFKFLGRAV------------------NTYIIASHQLEAGKMVMNCDWSK 83 Query: 129 PSTSDLLRPAQNAH 88 PSTS + AQN H Sbjct: 84 PSTSSFSQSAQNDH 97 Score = 25.0 bits (53), Expect(2) = 3e-14 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = -1 Query: 401 AKKSRNVAASLLAP 360 +KKSRN AASL+AP Sbjct: 24 SKKSRNEAASLIAP 37 >gb|AEN56111.1| ribosomal protein L2 [Cucumis melo subsp. melo] Length = 354 Score = 84.0 bits (206), Expect = 4e-14 Identities = 37/51 (72%), Positives = 42/51 (82%) Frame = -3 Query: 195 TYIIASHQLEAGKMVMNCDWSKPSTSDLLRPAQNAHTY*DLVHTAKKGRME 43 TY IASH+ AGKMVMNCDWSKPSTSDLLRPAQN HTY DL+H ++ + E Sbjct: 304 TYFIASHKCSAGKMVMNCDWSKPSTSDLLRPAQNGHTYSDLIHITQRRKAE 354 >ref|YP_008999589.1| ribosomal protein L2 (mitochondrion) [Vaccinium macrocarpon] gi|549531664|gb|AGX28803.1| ribosomal protein L2 (mitochondrion) [Vaccinium macrocarpon] Length = 335 Score = 82.4 bits (202), Expect = 1e-13 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -3 Query: 195 TYIIASHQLEAGKMVMNCDWSKPSTSDLLRPAQNAHTY 82 TYIIASH+LEAGKMVMNCDWSKPSTSDLLRPAQNAHTY Sbjct: 298 TYIIASHELEAGKMVMNCDWSKPSTSDLLRPAQNAHTY 335 >pir||S46947 ribosomal protein L2 - evening primrose mitochondrion (mitochondrion) [Oenothera villaricae] gi|516394|emb|CAA56451.1| 70s mitochondrial ribosomal protein L2 [Oenothera berteroana] Length = 332 Score = 82.0 bits (201), Expect = 2e-13 Identities = 37/38 (97%), Positives = 37/38 (97%) Frame = -3 Query: 195 TYIIASHQLEAGKMVMNCDWSKPSTSDLLRPAQNAHTY 82 TYIIASHQLEAGKMVMNCDWSKPSTSD LRPAQNAHTY Sbjct: 295 TYIIASHQLEAGKMVMNCDWSKPSTSDFLRPAQNAHTY 332 >ref|YP_002608368.1| ribosomal protein L2 [Vitis vinifera] gi|209954165|emb|CAQ77612.1| ribosomal protein L2 [Vitis vinifera] gi|239764759|gb|ACS15228.1| ribosomal protein L2 [Vitis vinifera] Length = 334 Score = 82.0 bits (201), Expect = 2e-13 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -3 Query: 195 TYIIASHQLEAGKMVMNCDWSKPSTSDLLRPAQNAHTY 82 TYIIASHQLEAGKMVMNCDWSKPSTSDLLRPA+NAHTY Sbjct: 297 TYIIASHQLEAGKMVMNCDWSKPSTSDLLRPARNAHTY 334 >gb|ALF04062.1| ribosomal protein L2 (mitochondrion) [Cannabis sativa] Length = 337 Score = 81.6 bits (200), Expect = 2e-13 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -3 Query: 195 TYIIASHQLEAGKMVMNCDWSKPSTSDLLRPAQNAHTY 82 TYIIASHQLEAGKMVMNC+WSKPSTSDLLRPAQNAHTY Sbjct: 300 TYIIASHQLEAGKMVMNCNWSKPSTSDLLRPAQNAHTY 337 >ref|YP_173485.1| ribosomal protein L2 [Nicotiana tabacum] gi|756762100|gb|AJM70209.1| ribosomal protein L2 (mitochondrion) [Nicotiana tabacum/Hyoscyamus niger cybrid] Length = 331 Score = 80.9 bits (198), Expect = 3e-13 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -3 Query: 195 TYIIASHQLEAGKMVMNCDWSKPSTSDLLRPAQNAHT 85 TYIIASHQLEAGKMVMNCDWSKPSTSDLLRPAQNAHT Sbjct: 294 TYIIASHQLEAGKMVMNCDWSKPSTSDLLRPAQNAHT 330 >ref|YP_009121961.1| ribosomal protein L2 (mitochondrion) [Hyoscyamus niger] gi|756142178|gb|AJK91389.1| ribosomal protein L2 (mitochondrion) [Hyoscyamus niger] Length = 331 Score = 80.9 bits (198), Expect = 3e-13 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -3 Query: 195 TYIIASHQLEAGKMVMNCDWSKPSTSDLLRPAQNAHT 85 TYIIASHQLEAGKMVMNCDWSKPSTSDLLRPAQNAHT Sbjct: 294 TYIIASHQLEAGKMVMNCDWSKPSTSDLLRPAQNAHT 330 >ref|XP_010314947.1| PREDICTED: LOW QUALITY PROTEIN: 60S ribosomal protein L2, mitochondrial, partial [Solanum lycopersicum] Length = 323 Score = 80.9 bits (198), Expect = 3e-13 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -3 Query: 195 TYIIASHQLEAGKMVMNCDWSKPSTSDLLRPAQNAHT 85 TYIIASHQLEAGKMVMNCDWSKPSTSDLLRPAQNAHT Sbjct: 286 TYIIASHQLEAGKMVMNCDWSKPSTSDLLRPAQNAHT 322 >ref|YP_009049780.1| ribosomal protein L2 (mitochondrion) [Capsicum annuum] gi|667752052|gb|AIG90138.1| ribosomal protein L2 (mitochondrion) [Capsicum annuum] Length = 332 Score = 80.9 bits (198), Expect = 3e-13 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -3 Query: 195 TYIIASHQLEAGKMVMNCDWSKPSTSDLLRPAQNAHT 85 TYIIASHQLEAGKMVMNCDWSKPSTSDLLRPAQNAHT Sbjct: 295 TYIIASHQLEAGKMVMNCDWSKPSTSDLLRPAQNAHT 331 >gb|AIG89877.1| ribosomal protein L2 (mitochondrion) [Capsicum annuum] Length = 329 Score = 80.9 bits (198), Expect = 3e-13 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -3 Query: 195 TYIIASHQLEAGKMVMNCDWSKPSTSDLLRPAQNAHT 85 TYIIASHQLEAGKMVMNCDWSKPSTSDLLRPAQNAHT Sbjct: 292 TYIIASHQLEAGKMVMNCDWSKPSTSDLLRPAQNAHT 328 >dbj|BAD83551.2| ribosomal protein L2 (mitochondrion) [Nicotiana tabacum] Length = 331 Score = 80.9 bits (198), Expect = 3e-13 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -3 Query: 195 TYIIASHQLEAGKMVMNCDWSKPSTSDLLRPAQNAHT 85 TYIIASHQLEAGKMVMNCDWSKPSTSDLLRPAQNAHT Sbjct: 294 TYIIASHQLEAGKMVMNCDWSKPSTSDLLRPAQNAHT 330