BLASTX nr result
ID: Cornus23_contig00043050
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00043050 (353 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPQ65002.1| Subunit with Mgr1p of the mitochondrial inner mem... 60 5e-07 emb|CCU75393.1| putative intermembrane space AAA protease IAP-1 ... 57 5e-06 >gb|EPQ65002.1| Subunit with Mgr1p of the mitochondrial inner membrane i-AAA protease complex [Blumeria graminis f. sp. tritici 96224] Length = 822 Score = 60.5 bits (145), Expect = 5e-07 Identities = 29/53 (54%), Positives = 37/53 (69%) Frame = -2 Query: 160 QYRTPGSALNLFAAHQKRTIFTNISRSNLAYIEEEANKYPNDANKQHKFYQAL 2 ++RT +A +L+ RT+F SR+ LA +EE ANKYPNDANKQ FYQAL Sbjct: 134 RHRTVKTATSLWVYQHSRTLFGRASRNTLALLEESANKYPNDANKQSVFYQAL 186 >emb|CCU75393.1| putative intermembrane space AAA protease IAP-1 [Blumeria graminis f. sp. hordei DH14] Length = 822 Score = 57.0 bits (136), Expect = 5e-06 Identities = 27/53 (50%), Positives = 35/53 (66%) Frame = -2 Query: 160 QYRTPGSALNLFAAHQKRTIFTNISRSNLAYIEEEANKYPNDANKQHKFYQAL 2 ++R + +L+ RT+F SR+ LA +EE ANKYPNDANKQ FYQAL Sbjct: 134 RHRKAKTVTSLWVYQHSRTLFGRASRNTLALLEESANKYPNDANKQSVFYQAL 186