BLASTX nr result
ID: Cornus23_contig00043011
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00043011 (381 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007831897.1| hypothetical protein PFICI_05125 [Pestalotio... 61 6e-10 >ref|XP_007831897.1| hypothetical protein PFICI_05125 [Pestalotiopsis fici W106-1] gi|573063598|gb|ETS83249.1| hypothetical protein PFICI_05125 [Pestalotiopsis fici W106-1] Length = 290 Score = 61.2 bits (147), Expect(2) = 6e-10 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -3 Query: 337 IAIPAATGKDFAWRRQAAADTERAPLLHDENN 242 IAIPAATGKDF WRRQA ADTERAPLLH E+N Sbjct: 259 IAIPAATGKDFGWRRQAQADTERAPLLHGESN 290 Score = 28.9 bits (63), Expect(2) = 6e-10 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = -1 Query: 381 FAFTIMAALFVATVAL 334 FAFTIMA LFVATV + Sbjct: 244 FAFTIMAVLFVATVGI 259