BLASTX nr result
ID: Cornus23_contig00042810
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00042810 (358 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010662540.1| PREDICTED: pentatricopeptide repeat-containi... 71 3e-10 emb|CBI31859.3| unnamed protein product [Vitis vinifera] 71 3e-10 >ref|XP_010662540.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22410, mitochondrial-like [Vitis vinifera] Length = 637 Score = 71.2 bits (173), Expect = 3e-10 Identities = 36/49 (73%), Positives = 41/49 (83%) Frame = -2 Query: 357 DDAMKMRELMEDGDVQKPSGWSSIEVEGVSSNSSQEPYLLQS*NRNEYS 211 DDAMKMRELMED DVQKPSG SSIEV+G+ SN SQEP LLQ RN+++ Sbjct: 569 DDAMKMRELMEDSDVQKPSGSSSIEVDGMVSNYSQEPGLLQVETRNDFT 617 >emb|CBI31859.3| unnamed protein product [Vitis vinifera] Length = 514 Score = 71.2 bits (173), Expect = 3e-10 Identities = 36/49 (73%), Positives = 41/49 (83%) Frame = -2 Query: 357 DDAMKMRELMEDGDVQKPSGWSSIEVEGVSSNSSQEPYLLQS*NRNEYS 211 DDAMKMRELMED DVQKPSG SSIEV+G+ SN SQEP LLQ RN+++ Sbjct: 446 DDAMKMRELMEDSDVQKPSGSSSIEVDGMVSNYSQEPGLLQVETRNDFT 494