BLASTX nr result
ID: Cornus23_contig00042792
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00042792 (385 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHJ33069.1| putative rrm domain-containing protein [Erysiphe ... 74 4e-11 gb|KFY61473.1| hypothetical protein V496_05001 [Pseudogymnoascus... 73 7e-11 gb|KFY36734.1| hypothetical protein V495_07647 [Pseudogymnoascus... 73 7e-11 gb|KFY35377.1| hypothetical protein V494_05972 [Pseudogymnoascus... 73 7e-11 gb|KFY18353.1| hypothetical protein V493_08698 [Pseudogymnoascus... 73 7e-11 gb|KFY11958.1| hypothetical protein V492_04174 [Pseudogymnoascus... 73 7e-11 gb|KFY09484.1| hypothetical protein V491_08141 [Pseudogymnoascus... 73 7e-11 gb|KFX99866.1| hypothetical protein V490_01611 [Pseudogymnoascus... 73 7e-11 gb|KFX88670.1| hypothetical protein O988_08936, partial [Pseudog... 73 7e-11 ref|XP_012739580.1| hypothetical protein GMDG_01183 [Pseudogymno... 73 7e-11 gb|KFZ05366.1| hypothetical protein V501_08429 [Pseudogymnoascus... 72 1e-10 gb|KFY78826.1| hypothetical protein V499_02071 [Pseudogymnoascus... 72 1e-10 gb|KFZ20741.1| hypothetical protein V502_03020 [Pseudogymnoascus... 72 2e-10 gb|KFY81360.1| hypothetical protein V500_11491 [Pseudogymnoascus... 72 2e-10 ref|XP_008080185.1| RNA-binding, RBD [Glarea lozoyensis ATCC 208... 71 3e-10 gb|EHK97251.1| putative Cleavage and polyadenylation specificity... 71 3e-10 gb|EMR89862.1| putative rrm domain-containing protein [Botrytis ... 70 8e-10 emb|CCD56534.1| hypothetical protein BofuT4_P147030.1 [Botrytis ... 70 8e-10 ref|XP_001545871.1| hypothetical protein BC1G_15622 [Botrytis ci... 70 8e-10 gb|ESZ89584.1| putative Cleavage and polyadenylation specificity... 69 1e-09 >gb|KHJ33069.1| putative rrm domain-containing protein [Erysiphe necator] Length = 394 Score = 73.9 bits (180), Expect = 4e-11 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = -1 Query: 202 FQGMQPHFNPAFFPSNQAAGGVWQNPHGIKRPRPE 98 FQGMQPHFNPAFFPSNQAAG WQNPHG+KR RPE Sbjct: 360 FQGMQPHFNPAFFPSNQAAGTDWQNPHGVKRQRPE 394 >gb|KFY61473.1| hypothetical protein V496_05001 [Pseudogymnoascus pannorum VKM F-4515 (FW-2607)] gi|682418958|gb|KFY88941.1| hypothetical protein V498_06586 [Pseudogymnoascus pannorum VKM F-4517 (FW-2822)] Length = 1227 Score = 73.2 bits (178), Expect = 7e-11 Identities = 30/35 (85%), Positives = 30/35 (85%) Frame = -1 Query: 202 FQGMQPHFNPAFFPSNQAAGGVWQNPHGIKRPRPE 98 F GMQPHFNPAFFP NQA GG WQNPHG KRPRPE Sbjct: 372 FPGMQPHFNPAFFPQNQATGGDWQNPHGAKRPRPE 406 >gb|KFY36734.1| hypothetical protein V495_07647 [Pseudogymnoascus pannorum VKM F-4514 (FW-929)] gi|682364537|gb|KFY51443.1| hypothetical protein V497_09127 [Pseudogymnoascus pannorum VKM F-4516 (FW-969)] Length = 1248 Score = 73.2 bits (178), Expect = 7e-11 Identities = 30/35 (85%), Positives = 30/35 (85%) Frame = -1 Query: 202 FQGMQPHFNPAFFPSNQAAGGVWQNPHGIKRPRPE 98 F GMQPHFNPAFFP NQA GG WQNPHG KRPRPE Sbjct: 373 FPGMQPHFNPAFFPQNQATGGDWQNPHGAKRPRPE 407 >gb|KFY35377.1| hypothetical protein V494_05972 [Pseudogymnoascus pannorum VKM F-4513 (FW-928)] Length = 898 Score = 73.2 bits (178), Expect = 7e-11 Identities = 30/35 (85%), Positives = 30/35 (85%) Frame = -1 Query: 202 FQGMQPHFNPAFFPSNQAAGGVWQNPHGIKRPRPE 98 F GMQPHFNPAFFP NQA GG WQNPHG KRPRPE Sbjct: 378 FPGMQPHFNPAFFPQNQATGGDWQNPHGAKRPRPE 412 >gb|KFY18353.1| hypothetical protein V493_08698 [Pseudogymnoascus pannorum VKM F-4281 (FW-2241)] Length = 406 Score = 73.2 bits (178), Expect = 7e-11 Identities = 30/35 (85%), Positives = 30/35 (85%) Frame = -1 Query: 202 FQGMQPHFNPAFFPSNQAAGGVWQNPHGIKRPRPE 98 F GMQPHFNPAFFP NQA GG WQNPHG KRPRPE Sbjct: 372 FPGMQPHFNPAFFPQNQATGGDWQNPHGAKRPRPE 406 >gb|KFY11958.1| hypothetical protein V492_04174 [Pseudogymnoascus pannorum VKM F-4246] Length = 896 Score = 73.2 bits (178), Expect = 7e-11 Identities = 30/35 (85%), Positives = 30/35 (85%) Frame = -1 Query: 202 FQGMQPHFNPAFFPSNQAAGGVWQNPHGIKRPRPE 98 F GMQPHFNPAFFP NQA GG WQNPHG KRPRPE Sbjct: 376 FPGMQPHFNPAFFPQNQATGGDWQNPHGAKRPRPE 410 >gb|KFY09484.1| hypothetical protein V491_08141 [Pseudogymnoascus pannorum VKM F-3775] Length = 1293 Score = 73.2 bits (178), Expect = 7e-11 Identities = 30/35 (85%), Positives = 30/35 (85%) Frame = -1 Query: 202 FQGMQPHFNPAFFPSNQAAGGVWQNPHGIKRPRPE 98 F GMQPHFNPAFFP NQA GG WQNPHG KRPRPE Sbjct: 371 FPGMQPHFNPAFFPQNQATGGDWQNPHGAKRPRPE 405 >gb|KFX99866.1| hypothetical protein V490_01611 [Pseudogymnoascus pannorum VKM F-3557] Length = 1248 Score = 73.2 bits (178), Expect = 7e-11 Identities = 30/35 (85%), Positives = 30/35 (85%) Frame = -1 Query: 202 FQGMQPHFNPAFFPSNQAAGGVWQNPHGIKRPRPE 98 F GMQPHFNPAFFP NQA GG WQNPHG KRPRPE Sbjct: 373 FPGMQPHFNPAFFPQNQATGGDWQNPHGAKRPRPE 407 >gb|KFX88670.1| hypothetical protein O988_08936, partial [Pseudogymnoascus pannorum VKM F-3808] Length = 1284 Score = 73.2 bits (178), Expect = 7e-11 Identities = 30/35 (85%), Positives = 30/35 (85%) Frame = -1 Query: 202 FQGMQPHFNPAFFPSNQAAGGVWQNPHGIKRPRPE 98 F GMQPHFNPAFFP NQA GG WQNPHG KRPRPE Sbjct: 406 FPGMQPHFNPAFFPQNQATGGDWQNPHGAKRPRPE 440 >ref|XP_012739580.1| hypothetical protein GMDG_01183 [Pseudogymnoascus destructans 20631-21] gi|440633281|gb|ELR03200.1| hypothetical protein GMDG_01183 [Pseudogymnoascus destructans 20631-21] Length = 404 Score = 73.2 bits (178), Expect = 7e-11 Identities = 30/35 (85%), Positives = 30/35 (85%) Frame = -1 Query: 202 FQGMQPHFNPAFFPSNQAAGGVWQNPHGIKRPRPE 98 F GMQPHFNPAFFP NQA GG WQNPHG KRPRPE Sbjct: 370 FPGMQPHFNPAFFPQNQATGGDWQNPHGAKRPRPE 404 >gb|KFZ05366.1| hypothetical protein V501_08429 [Pseudogymnoascus pannorum VKM F-4519 (FW-2642)] Length = 1226 Score = 72.4 bits (176), Expect = 1e-10 Identities = 38/65 (58%), Positives = 39/65 (60%) Frame = -1 Query: 202 FQGMQPHFNPAFFPSNQAAGGVWQNPHGIKRPRPE*YESLLKIEAHISNINLLVFSD*MD 23 F GMQPHFNPAFFP NQA GG WQNPHG KRPRP+ L I NI F Sbjct: 370 FPGMQPHFNPAFFPQNQATGGDWQNPHGAKRPRPD-INLALGRPTSIMNIRTTAFK---M 425 Query: 22 ASGGS 8 A GGS Sbjct: 426 AKGGS 430 >gb|KFY78826.1| hypothetical protein V499_02071 [Pseudogymnoascus pannorum VKM F-103] Length = 1226 Score = 72.4 bits (176), Expect = 1e-10 Identities = 38/65 (58%), Positives = 39/65 (60%) Frame = -1 Query: 202 FQGMQPHFNPAFFPSNQAAGGVWQNPHGIKRPRPE*YESLLKIEAHISNINLLVFSD*MD 23 F GMQPHFNPAFFP NQA GG WQNPHG KRPRP+ L I NI F Sbjct: 370 FPGMQPHFNPAFFPQNQATGGDWQNPHGAKRPRPD-INLALGRPTSIMNIRTTAFK---M 425 Query: 22 ASGGS 8 A GGS Sbjct: 426 AKGGS 430 >gb|KFZ20741.1| hypothetical protein V502_03020 [Pseudogymnoascus pannorum VKM F-4520 (FW-2644)] Length = 1232 Score = 72.0 bits (175), Expect = 2e-10 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = -1 Query: 202 FQGMQPHFNPAFFPSNQAAGGVWQNPHGIKRPRPE 98 F GMQPHFNPAFFP NQA GG WQNPHG KRPRP+ Sbjct: 371 FPGMQPHFNPAFFPQNQATGGDWQNPHGAKRPRPD 405 >gb|KFY81360.1| hypothetical protein V500_11491 [Pseudogymnoascus pannorum VKM F-4518 (FW-2643)] Length = 1232 Score = 72.0 bits (175), Expect = 2e-10 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = -1 Query: 202 FQGMQPHFNPAFFPSNQAAGGVWQNPHGIKRPRPE 98 F GMQPHFNPAFFP NQA GG WQNPHG KRPRP+ Sbjct: 371 FPGMQPHFNPAFFPQNQATGGDWQNPHGAKRPRPD 405 >ref|XP_008080185.1| RNA-binding, RBD [Glarea lozoyensis ATCC 20868] gi|512203349|gb|EPE32173.1| RNA-binding, RBD [Glarea lozoyensis ATCC 20868] Length = 404 Score = 71.2 bits (173), Expect = 3e-10 Identities = 30/35 (85%), Positives = 30/35 (85%) Frame = -1 Query: 202 FQGMQPHFNPAFFPSNQAAGGVWQNPHGIKRPRPE 98 F GMQPHFNPAFF NQAAGG WQNPHG KRPRPE Sbjct: 370 FGGMQPHFNPAFFQQNQAAGGDWQNPHGAKRPRPE 404 >gb|EHK97251.1| putative Cleavage and polyadenylation specificity factor subunit 6 [Glarea lozoyensis 74030] Length = 385 Score = 71.2 bits (173), Expect = 3e-10 Identities = 30/35 (85%), Positives = 30/35 (85%) Frame = -1 Query: 202 FQGMQPHFNPAFFPSNQAAGGVWQNPHGIKRPRPE 98 F GMQPHFNPAFF NQAAGG WQNPHG KRPRPE Sbjct: 351 FGGMQPHFNPAFFQQNQAAGGDWQNPHGAKRPRPE 385 >gb|EMR89862.1| putative rrm domain-containing protein [Botrytis cinerea BcDW1] Length = 403 Score = 69.7 bits (169), Expect = 8e-10 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = -1 Query: 202 FQGMQPHFNPAFFPSNQAAGGVWQNPHGIKRPRPE 98 FQ MQPHFNPAFF NQ+AGG WQNPHG KRPRPE Sbjct: 369 FQPMQPHFNPAFFQQNQSAGGDWQNPHGAKRPRPE 403 >emb|CCD56534.1| hypothetical protein BofuT4_P147030.1 [Botrytis cinerea T4] Length = 403 Score = 69.7 bits (169), Expect = 8e-10 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = -1 Query: 202 FQGMQPHFNPAFFPSNQAAGGVWQNPHGIKRPRPE 98 FQ MQPHFNPAFF NQ+AGG WQNPHG KRPRPE Sbjct: 369 FQPMQPHFNPAFFQQNQSAGGDWQNPHGAKRPRPE 403 >ref|XP_001545871.1| hypothetical protein BC1G_15622 [Botrytis cinerea B05.10] Length = 403 Score = 69.7 bits (169), Expect = 8e-10 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = -1 Query: 202 FQGMQPHFNPAFFPSNQAAGGVWQNPHGIKRPRPE 98 FQ MQPHFNPAFF NQ+AGG WQNPHG KRPRPE Sbjct: 369 FQPMQPHFNPAFFQQNQSAGGDWQNPHGAKRPRPE 403 >gb|ESZ89584.1| putative Cleavage and polyadenylation specificity factor subunit 6 [Sclerotinia borealis F-4157] Length = 408 Score = 69.3 bits (168), Expect = 1e-09 Identities = 29/35 (82%), Positives = 29/35 (82%) Frame = -1 Query: 202 FQGMQPHFNPAFFPSNQAAGGVWQNPHGIKRPRPE 98 FQ MQPHFNPAFF NQ AGG WQNPHG KRPRPE Sbjct: 374 FQPMQPHFNPAFFQQNQTAGGDWQNPHGAKRPRPE 408