BLASTX nr result
ID: Cornus23_contig00041980
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00041980 (363 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003842088.1| hypothetical protein LEMA_P078480.1 [Leptosp... 77 5e-18 ref|XP_007705354.1| hypothetical protein COCSADRAFT_261340 [Bipo... 74 3e-11 ref|XP_001940148.1| repressor of RNA polymerase III transcriptio... 74 3e-11 gb|KNG45515.1| repressor of rna polymerase iii transcription maf... 73 1e-10 ref|XP_007682314.1| hypothetical protein COCMIDRAFT_402 [Bipolar... 73 1e-10 ref|XP_007714073.1| hypothetical protein COCCADRAFT_38302 [Bipol... 73 1e-10 ref|XP_008022288.1| hypothetical protein SETTUDRAFT_159031 [Seto... 73 1e-10 ref|XP_014083105.1| hypothetical protein COCC4DRAFT_56718 [Bipol... 73 1e-10 ref|XP_003301875.1| hypothetical protein PTT_13476 [Pyrenophora ... 73 1e-10 gb|EMD90593.1| hypothetical protein COCHEDRAFT_1215558 [Bipolari... 72 2e-10 ref|XP_001800898.1| hypothetical protein SNOG_10634 [Parastagono... 70 5e-10 >ref|XP_003842088.1| hypothetical protein LEMA_P078480.1 [Leptosphaeria maculans JN3] gi|312218664|emb|CBX98609.1| hypothetical protein LEMA_P078480.1 [Leptosphaeria maculans JN3] Length = 476 Score = 76.6 bits (187), Expect(2) = 5e-18 Identities = 34/35 (97%), Positives = 34/35 (97%) Frame = -3 Query: 106 GVMKYLDLCALHEVNLALNFDTQDTAIIGGCDLWT 2 G MKYLDLCALHEVNLALNFDTQDTAIIGGCDLWT Sbjct: 134 GAMKYLDLCALHEVNLALNFDTQDTAIIGGCDLWT 168 Score = 40.8 bits (94), Expect(2) = 5e-18 Identities = 22/38 (57%), Positives = 25/38 (65%) Frame = -2 Query: 326 TSVWPNSSIHLSPQPA*SCVYSLYRFAQAIPSRNKGAP 213 T VWPN+ I S QPA S VY LYR +QA + NKG P Sbjct: 59 TVVWPNNDILFSLQPAWSSVYPLYRLSQATLT-NKGTP 95 >ref|XP_007705354.1| hypothetical protein COCSADRAFT_261340 [Bipolaris sorokiniana ND90Pr] gi|451845571|gb|EMD58883.1| hypothetical protein COCSADRAFT_261340 [Bipolaris sorokiniana ND90Pr] Length = 343 Score = 74.3 bits (181), Expect = 3e-11 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -3 Query: 100 MKYLDLCALHEVNLALNFDTQDTAIIGGCDLWT 2 MKYLDLCALHEVNLALNFDTQDTAIIGGCDLWT Sbjct: 1 MKYLDLCALHEVNLALNFDTQDTAIIGGCDLWT 33 >ref|XP_001940148.1| repressor of RNA polymerase III transcription MAF1 [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187976241|gb|EDU42867.1| repressor of RNA polymerase III transcription MAF1 [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 334 Score = 74.3 bits (181), Expect = 3e-11 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -3 Query: 100 MKYLDLCALHEVNLALNFDTQDTAIIGGCDLWT 2 MKYLDLCALHEVNLALNFDTQDTAIIGGCDLWT Sbjct: 1 MKYLDLCALHEVNLALNFDTQDTAIIGGCDLWT 33 >gb|KNG45515.1| repressor of rna polymerase iii transcription maf1 [Stemphylium lycopersici] Length = 487 Score = 72.8 bits (177), Expect = 1e-10 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -3 Query: 100 MKYLDLCALHEVNLALNFDTQDTAIIGGCDLWT 2 M+YLDLCALHEVNLALNFDTQDTAIIGGCDLWT Sbjct: 145 MEYLDLCALHEVNLALNFDTQDTAIIGGCDLWT 177 >ref|XP_007682314.1| hypothetical protein COCMIDRAFT_402 [Bipolaris oryzae ATCC 44560] gi|576937706|gb|EUC51193.1| hypothetical protein COCMIDRAFT_402 [Bipolaris oryzae ATCC 44560] Length = 487 Score = 72.8 bits (177), Expect = 1e-10 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -3 Query: 100 MKYLDLCALHEVNLALNFDTQDTAIIGGCDLWT 2 M+YLDLCALHEVNLALNFDTQDTAIIGGCDLWT Sbjct: 145 MEYLDLCALHEVNLALNFDTQDTAIIGGCDLWT 177 >ref|XP_007714073.1| hypothetical protein COCCADRAFT_38302 [Bipolaris zeicola 26-R-13] gi|953416673|ref|XP_014550408.1| hypothetical protein COCVIDRAFT_31838 [Bipolaris victoriae FI3] gi|576917394|gb|EUC31618.1| hypothetical protein COCCADRAFT_38302 [Bipolaris zeicola 26-R-13] gi|578483253|gb|EUN20834.1| hypothetical protein COCVIDRAFT_31838 [Bipolaris victoriae FI3] Length = 487 Score = 72.8 bits (177), Expect = 1e-10 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -3 Query: 100 MKYLDLCALHEVNLALNFDTQDTAIIGGCDLWT 2 M+YLDLCALHEVNLALNFDTQDTAIIGGCDLWT Sbjct: 145 MEYLDLCALHEVNLALNFDTQDTAIIGGCDLWT 177 >ref|XP_008022288.1| hypothetical protein SETTUDRAFT_159031 [Setosphaeria turcica Et28A] gi|482813755|gb|EOA90446.1| hypothetical protein SETTUDRAFT_159031 [Setosphaeria turcica Et28A] Length = 487 Score = 72.8 bits (177), Expect = 1e-10 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -3 Query: 100 MKYLDLCALHEVNLALNFDTQDTAIIGGCDLWT 2 M+YLDLCALHEVNLALNFDTQDTAIIGGCDLWT Sbjct: 145 MEYLDLCALHEVNLALNFDTQDTAIIGGCDLWT 177 >ref|XP_014083105.1| hypothetical protein COCC4DRAFT_56718 [Bipolaris maydis ATCC 48331] gi|477592125|gb|ENI09196.1| hypothetical protein COCC4DRAFT_56718 [Bipolaris maydis ATCC 48331] Length = 487 Score = 72.8 bits (177), Expect = 1e-10 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -3 Query: 100 MKYLDLCALHEVNLALNFDTQDTAIIGGCDLWT 2 M+YLDLCALHEVNLALNFDTQDTAIIGGCDLWT Sbjct: 145 MEYLDLCALHEVNLALNFDTQDTAIIGGCDLWT 177 >ref|XP_003301875.1| hypothetical protein PTT_13476 [Pyrenophora teres f. teres 0-1] gi|311323122|gb|EFQ90037.1| hypothetical protein PTT_13476 [Pyrenophora teres f. teres 0-1] Length = 486 Score = 72.8 bits (177), Expect = 1e-10 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -3 Query: 100 MKYLDLCALHEVNLALNFDTQDTAIIGGCDLWT 2 M+YLDLCALHEVNLALNFDTQDTAIIGGCDLWT Sbjct: 145 MEYLDLCALHEVNLALNFDTQDTAIIGGCDLWT 177 >gb|EMD90593.1| hypothetical protein COCHEDRAFT_1215558 [Bipolaris maydis C5] Length = 360 Score = 72.0 bits (175), Expect = 2e-10 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -3 Query: 103 VMKYLDLCALHEVNLALNFDTQDTAIIGGCDLWT 2 V +YLDLCALHEVNLALNFDTQDTAIIGGCDLWT Sbjct: 17 VTQYLDLCALHEVNLALNFDTQDTAIIGGCDLWT 50 >ref|XP_001800898.1| hypothetical protein SNOG_10634 [Parastagonospora nodorum SN15] gi|160702855|gb|EAT82028.2| hypothetical protein SNOG_10634 [Parastagonospora nodorum SN15] Length = 350 Score = 70.5 bits (171), Expect = 5e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 94 YLDLCALHEVNLALNFDTQDTAIIGGCDLWT 2 YLDLCALHEVNLALNFDTQDTAIIGGCDLWT Sbjct: 11 YLDLCALHEVNLALNFDTQDTAIIGGCDLWT 41