BLASTX nr result
ID: Cornus23_contig00041331
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00041331 (391 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008779341.1| PREDICTED: uncharacterized protein LOC103699... 43 2e-06 >ref|XP_008779341.1| PREDICTED: uncharacterized protein LOC103699074, partial [Phoenix dactylifera] Length = 347 Score = 43.1 bits (100), Expect(2) = 2e-06 Identities = 16/32 (50%), Positives = 25/32 (78%) Frame = +1 Query: 286 LQEVLCNENGYFFFKFSNEEDMNGVLERSPWH 381 L+EVL +E+G+FFFKF + E +L+++PWH Sbjct: 133 LKEVLASESGFFFFKFDSVEHACNILDKAPWH 164 Score = 35.4 bits (80), Expect(2) = 2e-06 Identities = 14/25 (56%), Positives = 18/25 (72%) Frame = +3 Query: 213 CHQHYACLVGYFINKRLPFPMVNSI 287 C A L+GYF+ +LPFP+VNSI Sbjct: 99 CEVWKATLIGYFVGNKLPFPIVNSI 123