BLASTX nr result
ID: Cornus23_contig00041319
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00041319 (359 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012837719.1| PREDICTED: uncharacterized protein LOC105958... 54 6e-06 >ref|XP_012837719.1| PREDICTED: uncharacterized protein LOC105958256 [Erythranthe guttatus] Length = 211 Score = 53.9 bits (128), Expect(2) = 6e-06 Identities = 22/46 (47%), Positives = 30/46 (65%) Frame = +2 Query: 155 KSDLKHHITRFMKTCSAGRTDEDIMAEQFVHSLKGYVLDWYTNLDP 292 K + K H+ ++TC+ T ED + +QFV SLKG DWYTNL+P Sbjct: 46 KGNSKQHVAHLVETCNNAGTFEDYLVKQFVRSLKGNAFDWYTNLEP 91 Score = 22.7 bits (47), Expect(2) = 6e-06 Identities = 9/22 (40%), Positives = 16/22 (72%) Frame = +1 Query: 289 PNSTES*NRLELGLFNCFHSTQ 354 PNS +S +++E + N F+ST+ Sbjct: 91 PNSIDSWSQMEQDILNRFYSTR 112