BLASTX nr result
ID: Cornus23_contig00041280
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00041280 (277 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010321079.1| PREDICTED: probable E3 ubiquitin-protein lig... 57 4e-06 ref|XP_004239288.2| PREDICTED: probable E3 ubiquitin-protein lig... 57 4e-06 ref|XP_007049410.1| RING/U-box superfamily protein, putative [Th... 57 5e-06 gb|ADW66146.1| RING-H2 zinc finger protein [Solanum nigrum] 57 5e-06 ref|XP_002533895.1| RING-H2 finger protein ATL3J, putative [Rici... 56 9e-06 >ref|XP_010321079.1| PREDICTED: probable E3 ubiquitin-protein ligase XERICO isoform X2 [Solanum lycopersicum] Length = 149 Score = 57.4 bits (137), Expect = 4e-06 Identities = 21/29 (72%), Positives = 24/29 (82%) Frame = -3 Query: 275 VFHKLCLENWLKNWRVTCPNCRTFVIPSE 189 VFHKLCLE WLKNW VTCP CR +++P E Sbjct: 115 VFHKLCLEKWLKNWNVTCPLCRNYIMPKE 143 >ref|XP_004239288.2| PREDICTED: probable E3 ubiquitin-protein ligase XERICO isoform X1 [Solanum lycopersicum] gi|723699826|ref|XP_010321077.1| PREDICTED: probable E3 ubiquitin-protein ligase XERICO isoform X1 [Solanum lycopersicum] gi|723699829|ref|XP_004239290.2| PREDICTED: probable E3 ubiquitin-protein ligase XERICO isoform X1 [Solanum lycopersicum] Length = 153 Score = 57.4 bits (137), Expect = 4e-06 Identities = 21/29 (72%), Positives = 24/29 (82%) Frame = -3 Query: 275 VFHKLCLENWLKNWRVTCPNCRTFVIPSE 189 VFHKLCLE WLKNW VTCP CR +++P E Sbjct: 115 VFHKLCLEKWLKNWNVTCPLCRNYIMPKE 143 >ref|XP_007049410.1| RING/U-box superfamily protein, putative [Theobroma cacao] gi|508701671|gb|EOX93567.1| RING/U-box superfamily protein, putative [Theobroma cacao] Length = 151 Score = 57.0 bits (136), Expect = 5e-06 Identities = 22/33 (66%), Positives = 26/33 (78%) Frame = -3 Query: 275 VFHKLCLENWLKNWRVTCPNCRTFVIPSEEDSC 177 +FHK+CLE WLK W VTCP CRT ++P EE SC Sbjct: 117 LFHKVCLEKWLKYWNVTCPLCRTPLLPEEEASC 149 >gb|ADW66146.1| RING-H2 zinc finger protein [Solanum nigrum] Length = 144 Score = 57.0 bits (136), Expect = 5e-06 Identities = 21/29 (72%), Positives = 24/29 (82%) Frame = -3 Query: 275 VFHKLCLENWLKNWRVTCPNCRTFVIPSE 189 VFHKLCLE WLKNW VTCP CR +++P E Sbjct: 116 VFHKLCLEKWLKNWNVTCPLCRDYIMPQE 144 >ref|XP_002533895.1| RING-H2 finger protein ATL3J, putative [Ricinus communis] gi|223526146|gb|EEF28485.1| RING-H2 finger protein ATL3J, putative [Ricinus communis] Length = 156 Score = 56.2 bits (134), Expect = 9e-06 Identities = 23/34 (67%), Positives = 27/34 (79%) Frame = -3 Query: 275 VFHKLCLENWLKNWRVTCPNCRTFVIPSEEDSCS 174 +FHK+CLE WL W VTCP CR+ VIPSEED+ S Sbjct: 120 LFHKVCLEKWLDYWNVTCPLCRSPVIPSEEDTSS 153