BLASTX nr result
ID: Cornus23_contig00041159
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00041159 (331 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003081247.1| unnamed protein product [Ostreococcus tauri] 76 9e-12 gb|KLJ06424.1| 40S ribosomal protein S9-B [Emmonsia parva UAMH 139] 71 3e-10 gb|KKZ60414.1| small subunit ribosomal protein S9e [Emmonsia cre... 71 3e-10 emb|CED83447.1| 40s ribosomal protein s9 [Xanthophyllomyces dend... 71 3e-10 ref|XP_013273613.1| 40S ribosomal protein S9 [Rhinocladiella mac... 71 3e-10 ref|XP_013282406.1| 40S ribosomal protein S9 [Fonsecaea pedrosoi... 71 3e-10 gb|KIW73335.1| 40S ribosomal protein S9 [Capronia semiimmersa] 71 3e-10 gb|KIW24305.1| 40S ribosomal protein S9 [Cladophialophora immunda] 71 3e-10 gb|EEH41907.2| 40S ribosomal protein S9 [Paracoccidioides lutzii... 71 3e-10 ref|XP_003347095.1| 40S ribosomal protein S9 [Sordaria macrospor... 71 3e-10 ref|XP_002794235.1| 40S ribosomal protein S9 [Paracoccidioides l... 71 3e-10 gb|EEH07566.1| 40S ribosomal protein S9 [Histoplasma capsulatum ... 71 3e-10 ref|XP_964233.1| 40S ribosomal protein S9 [Neurospora crassa OR7... 71 3e-10 ref|XP_007731850.1| 40S ribosomal protein S9 [Capronia epimyces ... 71 3e-10 ref|XP_007724904.1| 40S ribosomal protein S9 [Capronia coronata ... 71 3e-10 ref|XP_007752813.1| 40S ribosomal protein S9 [Cladophialophora y... 71 3e-10 ref|XP_007750565.1| 40S ribosomal protein S9 [Cladophialophora p... 71 3e-10 ref|XP_001222689.1| 40S ribosomal protein S9 [Chaetomium globosu... 71 3e-10 gb|EAQ71318.1| hypothetical protein MGCH7_ch7g725 [Magnaporthe o... 71 3e-10 ref|XP_008722253.1| 40S ribosomal protein S9 [Cladophialophora c... 71 3e-10 >ref|XP_003081247.1| unnamed protein product [Ostreococcus tauri] Length = 293 Score = 76.3 bits (186), Expect = 9e-12 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = +1 Query: 205 TRPGRPPPNGEVRAKSMCFWESRRTTNDGTLTICLPTRMWRW 330 TRPGRPPP+GE+ AKSMCFW S RT GT TICLPTR+WRW Sbjct: 50 TRPGRPPPSGELSAKSMCFWLSVRTKKLGTFTICLPTRIWRW 91 >gb|KLJ06424.1| 40S ribosomal protein S9-B [Emmonsia parva UAMH 139] Length = 189 Score = 71.2 bits (173), Expect = 3e-10 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -3 Query: 329 QRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPF 228 QRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPF Sbjct: 127 QRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPF 160 >gb|KKZ60414.1| small subunit ribosomal protein S9e [Emmonsia crescens UAMH 3008] Length = 186 Score = 71.2 bits (173), Expect = 3e-10 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -3 Query: 329 QRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPF 228 QRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPF Sbjct: 124 QRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPF 157 >emb|CED83447.1| 40s ribosomal protein s9 [Xanthophyllomyces dendrorhous] Length = 195 Score = 71.2 bits (173), Expect = 3e-10 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -3 Query: 329 QRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPF 228 QRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPF Sbjct: 131 QRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPF 164 >ref|XP_013273613.1| 40S ribosomal protein S9 [Rhinocladiella mackenziei CBS 650.93] gi|759330150|gb|KIX06477.1| 40S ribosomal protein S9 [Rhinocladiella mackenziei CBS 650.93] Length = 193 Score = 71.2 bits (173), Expect = 3e-10 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -3 Query: 329 QRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPF 228 QRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPF Sbjct: 129 QRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPF 162 >ref|XP_013282406.1| 40S ribosomal protein S9 [Fonsecaea pedrosoi CBS 271.37] gi|759302191|gb|KIW78598.1| 40S ribosomal protein S9 [Fonsecaea pedrosoi CBS 271.37] Length = 193 Score = 71.2 bits (173), Expect = 3e-10 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -3 Query: 329 QRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPF 228 QRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPF Sbjct: 129 QRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPF 162 >gb|KIW73335.1| 40S ribosomal protein S9 [Capronia semiimmersa] Length = 193 Score = 71.2 bits (173), Expect = 3e-10 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -3 Query: 329 QRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPF 228 QRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPF Sbjct: 129 QRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPF 162 >gb|KIW24305.1| 40S ribosomal protein S9 [Cladophialophora immunda] Length = 193 Score = 71.2 bits (173), Expect = 3e-10 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -3 Query: 329 QRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPF 228 QRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPF Sbjct: 129 QRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPF 162 >gb|EEH41907.2| 40S ribosomal protein S9 [Paracoccidioides lutzii Pb01] Length = 171 Score = 71.2 bits (173), Expect = 3e-10 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -3 Query: 329 QRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPF 228 QRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPF Sbjct: 109 QRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPF 142 >ref|XP_003347095.1| 40S ribosomal protein S9 [Sordaria macrospora k-hell] gi|380093790|emb|CCC08754.1| unnamed protein product [Sordaria macrospora k-hell] Length = 190 Score = 71.2 bits (173), Expect = 3e-10 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -3 Query: 329 QRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPF 228 QRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPF Sbjct: 129 QRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPF 162 >ref|XP_002794235.1| 40S ribosomal protein S9 [Paracoccidioides lutzii Pb01] gi|734677088|ref|XP_010758823.1| 40S ribosomal protein S9 [Paracoccidioides brasiliensis Pb18] gi|225680017|gb|EEH18301.1| 40S ribosomal protein S9 [Paracoccidioides brasiliensis Pb03] gi|226291800|gb|EEH47228.1| 40S ribosomal protein S9 [Paracoccidioides brasiliensis Pb18] Length = 191 Score = 71.2 bits (173), Expect = 3e-10 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -3 Query: 329 QRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPF 228 QRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPF Sbjct: 129 QRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPF 162 >gb|EEH07566.1| 40S ribosomal protein S9 [Histoplasma capsulatum G186AR] Length = 191 Score = 71.2 bits (173), Expect = 3e-10 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -3 Query: 329 QRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPF 228 QRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPF Sbjct: 129 QRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPF 162 >ref|XP_964233.1| 40S ribosomal protein S9 [Neurospora crassa OR74A] gi|698996934|ref|XP_009855448.1| 40S ribosomal protein S9 [Neurospora tetrasperma FGSC 2508] gi|28926006|gb|EAA34997.1| 40S ribosomal protein S9 [Neurospora crassa OR74A] gi|88866507|gb|ABD57302.1| unknown [Neurospora crassa] gi|336463565|gb|EGO51805.1| 40S ribosomal protein S9 [Neurospora tetrasperma FGSC 2508] gi|350297215|gb|EGZ78192.1| 40S ribosomal protein S9 [Neurospora tetrasperma FGSC 2509] gi|725976933|gb|KHE80363.1| 40S ribosomal protein S9 [Neurospora crassa] Length = 190 Score = 71.2 bits (173), Expect = 3e-10 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -3 Query: 329 QRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPF 228 QRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPF Sbjct: 129 QRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPF 162 >ref|XP_007731850.1| 40S ribosomal protein S9 [Capronia epimyces CBS 606.96] gi|590011367|gb|EXJ86571.1| 40S ribosomal protein S9 [Capronia epimyces CBS 606.96] Length = 193 Score = 71.2 bits (173), Expect = 3e-10 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -3 Query: 329 QRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPF 228 QRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPF Sbjct: 129 QRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPF 162 >ref|XP_007724904.1| 40S ribosomal protein S9 [Capronia coronata CBS 617.96] gi|590010261|gb|EXJ85466.1| 40S ribosomal protein S9 [Capronia coronata CBS 617.96] Length = 193 Score = 71.2 bits (173), Expect = 3e-10 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -3 Query: 329 QRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPF 228 QRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPF Sbjct: 129 QRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPF 162 >ref|XP_007752813.1| 40S ribosomal protein S9 [Cladophialophora yegresii CBS 114405] gi|589981005|gb|EXJ64246.1| 40S ribosomal protein S9 [Cladophialophora yegresii CBS 114405] Length = 196 Score = 71.2 bits (173), Expect = 3e-10 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -3 Query: 329 QRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPF 228 QRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPF Sbjct: 132 QRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPF 165 >ref|XP_007750565.1| 40S ribosomal protein S9 [Cladophialophora psammophila CBS 110553] gi|589978218|gb|EXJ61489.1| 40S ribosomal protein S9 [Cladophialophora psammophila CBS 110553] gi|759319470|gb|KIW95815.1| 40S ribosomal protein S9 [Cladophialophora bantiana CBS 173.52] Length = 192 Score = 71.2 bits (173), Expect = 3e-10 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -3 Query: 329 QRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPF 228 QRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPF Sbjct: 129 QRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPF 162 >ref|XP_001222689.1| 40S ribosomal protein S9 [Chaetomium globosum CBS 148.51] gi|88182507|gb|EAQ89975.1| 40S ribosomal protein S9 [Chaetomium globosum CBS 148.51] Length = 191 Score = 71.2 bits (173), Expect = 3e-10 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -3 Query: 329 QRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPF 228 QRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPF Sbjct: 129 QRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPF 162 >gb|EAQ71318.1| hypothetical protein MGCH7_ch7g725 [Magnaporthe oryzae 70-15] gi|440468672|gb|ELQ37822.1| 40S ribosomal protein S9 [Magnaporthe oryzae Y34] gi|440486607|gb|ELQ66456.1| 40S ribosomal protein S9 [Magnaporthe oryzae P131] Length = 180 Score = 71.2 bits (173), Expect = 3e-10 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -3 Query: 329 QRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPF 228 QRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPF Sbjct: 118 QRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPF 151 >ref|XP_008722253.1| 40S ribosomal protein S9 [Cladophialophora carrionii CBS 160.54] gi|565939073|gb|ETI28179.1| 40S ribosomal protein S9 [Cladophialophora carrionii CBS 160.54] Length = 193 Score = 71.2 bits (173), Expect = 3e-10 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -3 Query: 329 QRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPF 228 QRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPF Sbjct: 129 QRHIRVGKQIVNVPSFVVRLDSQKHIDFALTSPF 162