BLASTX nr result
ID: Cornus23_contig00040881
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00040881 (393 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013443670.1| hypothetical protein MTR_0002s0250 [Medicago... 60 8e-07 ref|XP_003599574.1| hypothetical protein MTR_3g035620 [Medicago ... 60 8e-07 ref|YP_588293.1| chloroplast hypothetical protein (mitochondrion... 57 4e-06 ref|XP_002455680.1| hypothetical protein SORBIDRAFT_03g020186, p... 57 5e-06 >ref|XP_013443670.1| hypothetical protein MTR_0002s0250 [Medicago truncatula] gi|657371714|gb|KEH17695.1| hypothetical protein MTR_0002s0250 [Medicago truncatula] Length = 213 Score = 59.7 bits (143), Expect = 8e-07 Identities = 37/57 (64%), Positives = 41/57 (71%), Gaps = 6/57 (10%) Frame = +3 Query: 96 PRLSI---IQT*IRDCLQWIPRH-ETRKGVL--RMLRGVENKHRSRYSQIGQPLELL 248 PRL + +QT R L WIPRH ETRKGV+ MLRGVENKHRS S+IGQP ELL Sbjct: 131 PRLQVKGEVQT--RKGLWWIPRHPETRKGVVSDEMLRGVENKHRSEDSRIGQPFELL 185 >ref|XP_003599574.1| hypothetical protein MTR_3g035620 [Medicago truncatula] gi|355488622|gb|AES69825.1| hypothetical protein MTR_3g035620 [Medicago truncatula] Length = 98 Score = 59.7 bits (143), Expect = 8e-07 Identities = 37/57 (64%), Positives = 41/57 (71%), Gaps = 6/57 (10%) Frame = +3 Query: 96 PRLSI---IQT*IRDCLQWIPRH-ETRKGVL--RMLRGVENKHRSRYSQIGQPLELL 248 PRL + +QT R L WIPRH ETRKGV+ MLRGVENKHRS S+IGQP ELL Sbjct: 16 PRLQVKGEVQT--RKGLWWIPRHPETRKGVVSDEMLRGVENKHRSEDSRIGQPFELL 70 >ref|YP_588293.1| chloroplast hypothetical protein (mitochondrion) [Zea mays subsp. mays] gi|40795075|gb|AAR91119.1| chloroplast hypothetical protein (mitochondrion) [Zea mays] Length = 121 Score = 57.4 bits (137), Expect = 4e-06 Identities = 32/43 (74%), Positives = 33/43 (76%), Gaps = 3/43 (6%) Frame = +3 Query: 126 RDCLQWIPRH-ETRKGVL--RMLRGVENKHRSRYSQIGQPLEL 245 R L+WIPRH ETRKGV MLRGVENKHRS SQIGQP EL Sbjct: 62 RKGLRWIPRHPETRKGVASDEMLRGVENKHRSGDSQIGQPFEL 104 >ref|XP_002455680.1| hypothetical protein SORBIDRAFT_03g020186, partial [Sorghum bicolor] gi|241927655|gb|EES00800.1| hypothetical protein SORBIDRAFT_03g020186, partial [Sorghum bicolor] Length = 57 Score = 57.0 bits (136), Expect = 5e-06 Identities = 31/40 (77%), Positives = 32/40 (80%), Gaps = 3/40 (7%) Frame = +3 Query: 135 LQWIPRH-ETRKGVL--RMLRGVENKHRSRYSQIGQPLEL 245 L+WIPRH ETRKGV MLRGVENKHRS SQIGQP EL Sbjct: 1 LRWIPRHPETRKGVASDEMLRGVENKHRSGDSQIGQPFEL 40