BLASTX nr result
ID: Cornus23_contig00040840
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00040840 (347 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KIW40901.1| hypothetical protein, variant 2 [Exophiala oligos... 57 7e-06 gb|KIW40899.1| hypothetical protein PV06_06511 [Exophiala oligos... 57 7e-06 >gb|KIW40901.1| hypothetical protein, variant 2 [Exophiala oligosperma] Length = 763 Score = 56.6 bits (135), Expect = 7e-06 Identities = 24/40 (60%), Positives = 33/40 (82%) Frame = -3 Query: 120 LSTTTAVKCEVMIQYLRQRQIEKLWTDGNVSEGVVLKRAK 1 L T A KC++M+++LRQRQ+EKLW++ + EGVVLKRAK Sbjct: 47 LGTAGAFKCDIMVKFLRQRQMEKLWSNSDFEEGVVLKRAK 86 >gb|KIW40899.1| hypothetical protein PV06_06511 [Exophiala oligosperma] gi|759264377|gb|KIW40900.1| hypothetical protein, variant 1 [Exophiala oligosperma] Length = 888 Score = 56.6 bits (135), Expect = 7e-06 Identities = 24/40 (60%), Positives = 33/40 (82%) Frame = -3 Query: 120 LSTTTAVKCEVMIQYLRQRQIEKLWTDGNVSEGVVLKRAK 1 L T A KC++M+++LRQRQ+EKLW++ + EGVVLKRAK Sbjct: 47 LGTAGAFKCDIMVKFLRQRQMEKLWSNSDFEEGVVLKRAK 86