BLASTX nr result
ID: Cornus23_contig00040834
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00040834 (379 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009791075.1| PREDICTED: pentatricopeptide repeat-containi... 60 6e-07 ref|XP_009588009.1| PREDICTED: pentatricopeptide repeat-containi... 60 6e-07 ref|XP_009588008.1| PREDICTED: pentatricopeptide repeat-containi... 60 6e-07 ref|XP_012849322.1| PREDICTED: pentatricopeptide repeat-containi... 59 1e-06 emb|CDP07934.1| unnamed protein product [Coffea canephora] 58 3e-06 gb|KNA11241.1| hypothetical protein SOVF_136990 isoform B [Spina... 57 5e-06 gb|KNA11240.1| hypothetical protein SOVF_136990 isoform A [Spina... 57 5e-06 ref|XP_010674212.1| PREDICTED: pentatricopeptide repeat-containi... 56 9e-06 ref|XP_006358787.1| PREDICTED: pentatricopeptide repeat-containi... 56 9e-06 ref|XP_004248026.1| PREDICTED: pentatricopeptide repeat-containi... 56 9e-06 >ref|XP_009791075.1| PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial [Nicotiana sylvestris] gi|698488995|ref|XP_009791076.1| PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial [Nicotiana sylvestris] Length = 472 Score = 60.1 bits (144), Expect = 6e-07 Identities = 30/55 (54%), Positives = 34/55 (61%) Frame = -3 Query: 167 RSLKTLTSPTEHGPKFTXXXXXXXXGMSNDDYFAAVHHISNIVRRDIYMERTLNK 3 R LKT+T + + NDDYFA +HHISNIVRRDIYMERTLNK Sbjct: 27 RCLKTITPSVDPDSNPFGGKGSCSRSVPNDDYFATIHHISNIVRRDIYMERTLNK 81 >ref|XP_009588009.1| PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial isoform X2 [Nicotiana tomentosiformis] gi|697158496|ref|XP_009588010.1| PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial isoform X2 [Nicotiana tomentosiformis] gi|697158498|ref|XP_009588011.1| PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial isoform X2 [Nicotiana tomentosiformis] gi|697158500|ref|XP_009588012.1| PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial isoform X2 [Nicotiana tomentosiformis] Length = 472 Score = 60.1 bits (144), Expect = 6e-07 Identities = 30/55 (54%), Positives = 34/55 (61%) Frame = -3 Query: 167 RSLKTLTSPTEHGPKFTXXXXXXXXGMSNDDYFAAVHHISNIVRRDIYMERTLNK 3 R LKT+T + + NDDYFA +HHISNIVRRDIYMERTLNK Sbjct: 27 RCLKTITPSVDPDSNPFGGKGSCSRSVPNDDYFATIHHISNIVRRDIYMERTLNK 81 >ref|XP_009588008.1| PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial isoform X1 [Nicotiana tomentosiformis] Length = 487 Score = 60.1 bits (144), Expect = 6e-07 Identities = 30/55 (54%), Positives = 34/55 (61%) Frame = -3 Query: 167 RSLKTLTSPTEHGPKFTXXXXXXXXGMSNDDYFAAVHHISNIVRRDIYMERTLNK 3 R LKT+T + + NDDYFA +HHISNIVRRDIYMERTLNK Sbjct: 42 RCLKTITPSVDPDSNPFGGKGSCSRSVPNDDYFATIHHISNIVRRDIYMERTLNK 96 >ref|XP_012849322.1| PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial [Erythranthe guttatus] gi|604315190|gb|EYU27896.1| hypothetical protein MIMGU_mgv1a005951mg [Erythranthe guttata] Length = 463 Score = 58.9 bits (141), Expect = 1e-06 Identities = 30/53 (56%), Positives = 35/53 (66%) Frame = -3 Query: 161 LKTLTSPTEHGPKFTXXXXXXXXGMSNDDYFAAVHHISNIVRRDIYMERTLNK 3 +KTLT+ T G+ NDDYFA +HHISNIVRRDIY+ERTLNK Sbjct: 20 IKTLTTATNFIQGSGGTTTTTARGLPNDDYFATIHHISNIVRRDIYLERTLNK 72 >emb|CDP07934.1| unnamed protein product [Coffea canephora] Length = 464 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/28 (89%), Positives = 26/28 (92%) Frame = -3 Query: 86 SNDDYFAAVHHISNIVRRDIYMERTLNK 3 SNDDYF +HHISNIVRRDIYMERTLNK Sbjct: 46 SNDDYFVTIHHISNIVRRDIYMERTLNK 73 >gb|KNA11241.1| hypothetical protein SOVF_136990 isoform B [Spinacia oleracea] Length = 651 Score = 57.0 bits (136), Expect = 5e-06 Identities = 24/28 (85%), Positives = 28/28 (100%) Frame = -3 Query: 86 SNDDYFAAVHHISNIVRRDIYMERTLNK 3 +ND+YFAA+HHISNIVRRDIY+ERTLNK Sbjct: 57 TNDEYFAAIHHISNIVRRDIYLERTLNK 84 >gb|KNA11240.1| hypothetical protein SOVF_136990 isoform A [Spinacia oleracea] Length = 679 Score = 57.0 bits (136), Expect = 5e-06 Identities = 24/28 (85%), Positives = 28/28 (100%) Frame = -3 Query: 86 SNDDYFAAVHHISNIVRRDIYMERTLNK 3 +ND+YFAA+HHISNIVRRDIY+ERTLNK Sbjct: 57 TNDEYFAAIHHISNIVRRDIYLERTLNK 84 >ref|XP_010674212.1| PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial [Beta vulgaris subsp. vulgaris] gi|870862677|gb|KMT13865.1| hypothetical protein BVRB_4g077070 [Beta vulgaris subsp. vulgaris] Length = 472 Score = 56.2 bits (134), Expect = 9e-06 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = -3 Query: 86 SNDDYFAAVHHISNIVRRDIYMERTLNK 3 + DDYFAA+HHISNIVRRDIY+ERTLNK Sbjct: 51 TKDDYFAAIHHISNIVRRDIYLERTLNK 78 >ref|XP_006358787.1| PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial-like isoform X1 [Solanum tuberosum] gi|565385886|ref|XP_006358788.1| PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial-like isoform X2 [Solanum tuberosum] gi|565385889|ref|XP_006358789.1| PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial-like isoform X3 [Solanum tuberosum] Length = 472 Score = 56.2 bits (134), Expect = 9e-06 Identities = 23/27 (85%), Positives = 26/27 (96%) Frame = -3 Query: 83 NDDYFAAVHHISNIVRRDIYMERTLNK 3 NDDYFA +HH+SNIVRRDIY+ERTLNK Sbjct: 55 NDDYFATIHHVSNIVRRDIYLERTLNK 81 >ref|XP_004248026.1| PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial [Solanum lycopersicum] gi|723733507|ref|XP_010326954.1| PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial [Solanum lycopersicum] gi|723733510|ref|XP_010326956.1| PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial [Solanum lycopersicum] Length = 470 Score = 56.2 bits (134), Expect = 9e-06 Identities = 23/27 (85%), Positives = 26/27 (96%) Frame = -3 Query: 83 NDDYFAAVHHISNIVRRDIYMERTLNK 3 NDDYFA +HH+SNIVRRDIY+ERTLNK Sbjct: 53 NDDYFATIHHVSNIVRRDIYLERTLNK 79