BLASTX nr result
ID: Cornus23_contig00040582
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00040582 (277 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013192245.1| PREDICTED: RNA-directed DNA polymerase from ... 77 7e-12 gb|EYB97171.1| hypothetical protein Y032_0143g2429 [Ancylostoma ... 74 3e-11 gb|EYC13748.1| hypothetical protein Y032_0042g496 [Ancylostoma c... 72 1e-10 gb|EYC46273.1| hypothetical protein Y032_0402g801 [Ancylostoma c... 72 2e-10 emb|CBA11992.1| endonuclease-reverse transcriptase HmRTE-e01 [He... 72 2e-10 gb|KRH05916.1| hypothetical protein GLYMA_17G256100 [Glycine max] 72 2e-10 gb|EYC46303.1| hypothetical protein Y032_0402g814 [Ancylostoma c... 72 2e-10 gb|EYC43100.1| hypothetical protein Y032_0503g2638 [Ancylostoma ... 72 2e-10 gb|EYC40457.1| hypothetical protein Y032_0611g633 [Ancylostoma c... 72 2e-10 gb|EYC36392.1| hypothetical protein Y032_0900g2943 [Ancylostoma ... 72 2e-10 gb|EYC26232.1| hypothetical protein Y032_0010g1031 [Ancylostoma ... 72 2e-10 gb|EYC26231.1| hypothetical protein Y032_0010g1031 [Ancylostoma ... 72 2e-10 gb|EYC20465.1| hypothetical protein Y032_0022g637 [Ancylostoma c... 72 2e-10 gb|EYC17423.1| hypothetical protein Y032_0030g2039 [Ancylostoma ... 72 2e-10 gb|EYC15239.1| hypothetical protein Y032_0037g3407 [Ancylostoma ... 72 2e-10 gb|EYC13301.1| hypothetical protein Y032_0044g903 [Ancylostoma c... 72 2e-10 gb|EYC10519.1| hypothetical protein Y032_0055g2599 [Ancylostoma ... 72 2e-10 gb|EYC00158.1| hypothetical protein Y032_0117g642 [Ancylostoma c... 72 2e-10 gb|EYB99857.1| hypothetical protein Y032_0119g807 [Ancylostoma c... 72 2e-10 gb|EYB99710.1| hypothetical protein Y032_0120g898 [Ancylostoma c... 72 2e-10 >ref|XP_013192245.1| PREDICTED: RNA-directed DNA polymerase from mobile element jockey-like, partial [Amyelois transitella] Length = 472 Score = 76.6 bits (187), Expect = 7e-12 Identities = 38/85 (44%), Positives = 55/85 (64%) Frame = +1 Query: 7 DGDI*VR*KNYFQNLLKEKYPREEVEIN*FNIGMINKITNKGVEDTLKKMKSNKAVCPDN 186 D DI R + Y+Q LL E++PRE I G + I+ + V+ ++KMK+ KA PD Sbjct: 250 DKDITKRWQEYYQTLLNEEFPRETFAILPCPEGPVEAISLQEVKTAIQKMKNRKATGPDE 309 Query: 187 IPIEAWRTLGNVGI*WLTRLFNNIL 261 IP E W+++G++GI WLT+LFN IL Sbjct: 310 IPAELWKSMGDIGIAWLTKLFNEIL 334 >gb|EYB97171.1| hypothetical protein Y032_0143g2429 [Ancylostoma ceylanicum] Length = 872 Score = 74.3 bits (181), Expect = 3e-11 Identities = 36/80 (45%), Positives = 49/80 (61%) Frame = +1 Query: 37 YFQNLLKEKYPREEVEIN*FNIGMINKITNKGVEDTLKKMKSNKAVCPDNIPIEAWRTLG 216 YF++LL E++PR+E G + T V +KKMK+ KA PD IP+EAWR+LG Sbjct: 463 YFEHLLNEEFPRKERNSAEPAAGPMQPWTVDEVRKAIKKMKAGKATGPDGIPVEAWRSLG 522 Query: 217 NVGI*WLTRLFNNILKQGMM 276 +G+ WLT FNNI + M Sbjct: 523 ELGVRWLTEFFNNITRSAKM 542 >gb|EYC13748.1| hypothetical protein Y032_0042g496 [Ancylostoma ceylanicum] Length = 339 Score = 72.4 bits (176), Expect = 1e-10 Identities = 35/80 (43%), Positives = 49/80 (61%) Frame = +1 Query: 37 YFQNLLKEKYPREEVEIN*FNIGMINKITNKGVEDTLKKMKSNKAVCPDNIPIEAWRTLG 216 YF++LL E++PR G + T V +KKMK++KA PD IP+EAWR+LG Sbjct: 240 YFEHLLNEEFPRRPKAPAEPIAGPMQPWTVNEVRKAIKKMKADKATGPDGIPVEAWRSLG 299 Query: 217 NVGI*WLTRLFNNILKQGMM 276 +G+ WLT+ FNNI + M Sbjct: 300 ELGVRWLTKFFNNITRSAKM 319 >gb|EYC46273.1| hypothetical protein Y032_0402g801 [Ancylostoma ceylanicum] Length = 982 Score = 72.0 bits (175), Expect = 2e-10 Identities = 36/84 (42%), Positives = 50/84 (59%) Frame = +1 Query: 25 R*KNYFQNLLKEKYPREEVEIN*FNIGMINKITNKGVEDTLKKMKSNKAVCPDNIPIEAW 204 R + YF++LL E++PR+ G + T V +KKMK+ KA PD IP+EAW Sbjct: 462 RWRAYFEHLLNEEFPRKPKAPAEPVAGPMQPWTADEVRKAIKKMKAGKATGPDGIPVEAW 521 Query: 205 RTLGNVGI*WLTRLFNNILKQGMM 276 R+LG +G+ WLT FNNI + M Sbjct: 522 RSLGELGVRWLTEFFNNITRSAKM 545 >emb|CBA11992.1| endonuclease-reverse transcriptase HmRTE-e01 [Heliconius melpomene] Length = 990 Score = 72.0 bits (175), Expect = 2e-10 Identities = 38/84 (45%), Positives = 55/84 (65%) Frame = +1 Query: 25 R*KNYFQNLLKEKYPREEVEIN*FNIGMINKITNKGVEDTLKKMKSNKAVCPDNIPIEAW 204 R ++YFQ LL ++P N+G+I IT + L++MK+ KAV PD+IPIEAW Sbjct: 472 RWRSYFQELLNTQHPCSLHHDPPPNLGLIAPITLDETRNCLRRMKNGKAVGPDDIPIEAW 531 Query: 205 RTLGNVGI*WLTRLFNNILKQGMM 276 ++LG++G+ LT LFN+IL G M Sbjct: 532 KSLGSLGVLMLTDLFNHILNTGKM 555 >gb|KRH05916.1| hypothetical protein GLYMA_17G256100 [Glycine max] Length = 959 Score = 71.6 bits (174), Expect = 2e-10 Identities = 39/96 (40%), Positives = 56/96 (58%), Gaps = 4/96 (4%) Frame = +1 Query: 1 VKDGDI*VR*KNYFQNLLKEKYPREEVEIN*F----NIGMINKITNKGVEDTLKKMKSNK 168 V + DI R K YF NL + Y + ++ N +I + V++ LK+M + K Sbjct: 809 VHEKDIKERWKAYFHNLFNDGYGYDSSSLDTREEDRNYKYYRRIQKQEVKEALKRMSNGK 868 Query: 169 AVCPDNIPIEAWRTLGNVGI*WLTRLFNNILKQGMM 276 AV PDNIPIE W+TLG+ G+ WLT+LFN I++ M Sbjct: 869 AVGPDNIPIEVWKTLGDRGLEWLTKLFNEIMRSKRM 904 >gb|EYC46303.1| hypothetical protein Y032_0402g814 [Ancylostoma ceylanicum] Length = 986 Score = 71.6 bits (174), Expect = 2e-10 Identities = 35/80 (43%), Positives = 48/80 (60%) Frame = +1 Query: 37 YFQNLLKEKYPREEVEIN*FNIGMINKITNKGVEDTLKKMKSNKAVCPDNIPIEAWRTLG 216 YF++LL E++PR+ G + T V +KKMK+ KA PD IP+EAWR+LG Sbjct: 470 YFEHLLNEEFPRKPKAPAEPVAGPMQPWTADEVRKAIKKMKAGKATGPDGIPVEAWRSLG 529 Query: 217 NVGI*WLTRLFNNILKQGMM 276 +G+ WLT FNNI + M Sbjct: 530 ELGVRWLTEFFNNITRSAKM 549 >gb|EYC43100.1| hypothetical protein Y032_0503g2638 [Ancylostoma ceylanicum] Length = 982 Score = 71.6 bits (174), Expect = 2e-10 Identities = 35/80 (43%), Positives = 48/80 (60%) Frame = +1 Query: 37 YFQNLLKEKYPREEVEIN*FNIGMINKITNKGVEDTLKKMKSNKAVCPDNIPIEAWRTLG 216 YF++LL E++PR+ G + T V +KKMK+ KA PD IP+EAWR+LG Sbjct: 466 YFEHLLNEEFPRKPKAPAEPVAGPMQPWTADEVRKAIKKMKAGKATGPDGIPVEAWRSLG 525 Query: 217 NVGI*WLTRLFNNILKQGMM 276 +G+ WLT FNNI + M Sbjct: 526 ELGVRWLTEFFNNITRSAKM 545 >gb|EYC40457.1| hypothetical protein Y032_0611g633 [Ancylostoma ceylanicum] Length = 982 Score = 71.6 bits (174), Expect = 2e-10 Identities = 35/80 (43%), Positives = 48/80 (60%) Frame = +1 Query: 37 YFQNLLKEKYPREEVEIN*FNIGMINKITNKGVEDTLKKMKSNKAVCPDNIPIEAWRTLG 216 YF++LL E++PR+ G + T V +KKMK+ KA PD IP+EAWR+LG Sbjct: 466 YFEHLLNEEFPRKPKAPAEPVAGPMQPWTADEVRKAIKKMKAGKATGPDGIPVEAWRSLG 525 Query: 217 NVGI*WLTRLFNNILKQGMM 276 +G+ WLT FNNI + M Sbjct: 526 ELGVRWLTEFFNNITRSAKM 545 >gb|EYC36392.1| hypothetical protein Y032_0900g2943 [Ancylostoma ceylanicum] Length = 726 Score = 71.6 bits (174), Expect = 2e-10 Identities = 35/80 (43%), Positives = 48/80 (60%) Frame = +1 Query: 37 YFQNLLKEKYPREEVEIN*FNIGMINKITNKGVEDTLKKMKSNKAVCPDNIPIEAWRTLG 216 YF++LL E++PR+ G + T V +KKMK+ KA PD IP+EAWR+LG Sbjct: 466 YFEHLLNEEFPRKPKAPAEPVAGPMQPWTADEVRKAIKKMKAGKATGPDGIPVEAWRSLG 525 Query: 217 NVGI*WLTRLFNNILKQGMM 276 +G+ WLT FNNI + M Sbjct: 526 ELGVRWLTEFFNNITRSAKM 545 >gb|EYC26232.1| hypothetical protein Y032_0010g1031 [Ancylostoma ceylanicum] Length = 756 Score = 71.6 bits (174), Expect = 2e-10 Identities = 35/80 (43%), Positives = 48/80 (60%) Frame = +1 Query: 37 YFQNLLKEKYPREEVEIN*FNIGMINKITNKGVEDTLKKMKSNKAVCPDNIPIEAWRTLG 216 YF++LL E++PR+ G + T V +KKMK+ KA PD IP+EAWR+LG Sbjct: 240 YFEHLLNEEFPRKPKAPAEPVAGPMQPWTADEVRKAIKKMKAGKATGPDGIPVEAWRSLG 299 Query: 217 NVGI*WLTRLFNNILKQGMM 276 +G+ WLT FNNI + M Sbjct: 300 ELGVRWLTEFFNNITRSAKM 319 >gb|EYC26231.1| hypothetical protein Y032_0010g1031 [Ancylostoma ceylanicum] Length = 982 Score = 71.6 bits (174), Expect = 2e-10 Identities = 35/80 (43%), Positives = 48/80 (60%) Frame = +1 Query: 37 YFQNLLKEKYPREEVEIN*FNIGMINKITNKGVEDTLKKMKSNKAVCPDNIPIEAWRTLG 216 YF++LL E++PR+ G + T V +KKMK+ KA PD IP+EAWR+LG Sbjct: 466 YFEHLLNEEFPRKPKAPAEPVAGPMQPWTADEVRKAIKKMKAGKATGPDGIPVEAWRSLG 525 Query: 217 NVGI*WLTRLFNNILKQGMM 276 +G+ WLT FNNI + M Sbjct: 526 ELGVRWLTEFFNNITRSAKM 545 >gb|EYC20465.1| hypothetical protein Y032_0022g637 [Ancylostoma ceylanicum] Length = 574 Score = 71.6 bits (174), Expect = 2e-10 Identities = 35/80 (43%), Positives = 48/80 (60%) Frame = +1 Query: 37 YFQNLLKEKYPREEVEIN*FNIGMINKITNKGVEDTLKKMKSNKAVCPDNIPIEAWRTLG 216 YF++LL E++PR+ G + T V +KKMK+ KA PD IP+EAWR+LG Sbjct: 58 YFEHLLNEEFPRKPKAPAEPVAGPMQPWTADEVRKAIKKMKAGKATGPDGIPVEAWRSLG 117 Query: 217 NVGI*WLTRLFNNILKQGMM 276 +G+ WLT FNNI + M Sbjct: 118 ELGVRWLTEFFNNITRSAKM 137 >gb|EYC17423.1| hypothetical protein Y032_0030g2039 [Ancylostoma ceylanicum] Length = 671 Score = 71.6 bits (174), Expect = 2e-10 Identities = 35/80 (43%), Positives = 48/80 (60%) Frame = +1 Query: 37 YFQNLLKEKYPREEVEIN*FNIGMINKITNKGVEDTLKKMKSNKAVCPDNIPIEAWRTLG 216 YF++LL E++PR+ G + T V +KKMK+ KA PD IP+EAWR+LG Sbjct: 240 YFEHLLNEEFPRKPKAPAEPVAGPMQPWTADEVRKAIKKMKAGKATGPDGIPVEAWRSLG 299 Query: 217 NVGI*WLTRLFNNILKQGMM 276 +G+ WLT FNNI + M Sbjct: 300 ELGVRWLTEFFNNITRSAKM 319 >gb|EYC15239.1| hypothetical protein Y032_0037g3407 [Ancylostoma ceylanicum] Length = 498 Score = 71.6 bits (174), Expect = 2e-10 Identities = 35/80 (43%), Positives = 51/80 (63%) Frame = +1 Query: 25 R*KNYFQNLLKEKYPREEVEIN*FNIGMINKITNKGVEDTLKKMKSNKAVCPDNIPIEAW 204 R + YF +LL E++PR+++ + G + T V +KKMK KA PD IP+EAW Sbjct: 54 RWRAYFAHLLNEEFPRKKIFLGQPVAGPVQPWTVDEVRKAVKKMKVGKAPGPDGIPMEAW 113 Query: 205 RTLGNVGI*WLTRLFNNILK 264 R+LG +G+ WLT+ FNNI + Sbjct: 114 RSLGELGLQWLTKFFNNITR 133 >gb|EYC13301.1| hypothetical protein Y032_0044g903 [Ancylostoma ceylanicum] Length = 986 Score = 71.6 bits (174), Expect = 2e-10 Identities = 35/80 (43%), Positives = 48/80 (60%) Frame = +1 Query: 37 YFQNLLKEKYPREEVEIN*FNIGMINKITNKGVEDTLKKMKSNKAVCPDNIPIEAWRTLG 216 YF++LL E++PR+ G + T V +KKMK+ KA PD IP+EAWR+LG Sbjct: 470 YFEHLLNEEFPRKPKAPAEPVAGPMQPWTADEVRKAIKKMKAGKATGPDGIPVEAWRSLG 529 Query: 217 NVGI*WLTRLFNNILKQGMM 276 +G+ WLT FNNI + M Sbjct: 530 ELGVRWLTEFFNNITRSAKM 549 >gb|EYC10519.1| hypothetical protein Y032_0055g2599 [Ancylostoma ceylanicum] Length = 982 Score = 71.6 bits (174), Expect = 2e-10 Identities = 35/80 (43%), Positives = 48/80 (60%) Frame = +1 Query: 37 YFQNLLKEKYPREEVEIN*FNIGMINKITNKGVEDTLKKMKSNKAVCPDNIPIEAWRTLG 216 YF++LL E++PR+ G + T V +KKMK+ KA PD IP+EAWR+LG Sbjct: 466 YFEHLLNEEFPRKPKAPAEPVAGPMQPWTADEVRKAIKKMKAGKATGPDGIPVEAWRSLG 525 Query: 217 NVGI*WLTRLFNNILKQGMM 276 +G+ WLT FNNI + M Sbjct: 526 ELGVRWLTEFFNNITRSAKM 545 >gb|EYC00158.1| hypothetical protein Y032_0117g642 [Ancylostoma ceylanicum] Length = 982 Score = 71.6 bits (174), Expect = 2e-10 Identities = 35/80 (43%), Positives = 48/80 (60%) Frame = +1 Query: 37 YFQNLLKEKYPREEVEIN*FNIGMINKITNKGVEDTLKKMKSNKAVCPDNIPIEAWRTLG 216 YF++LL E++PR+ G + T V +KKMK+ KA PD IP+EAWR+LG Sbjct: 466 YFEHLLNEEFPRKPKAPAEPVAGPMQPWTADEVRKAIKKMKAGKATGPDGIPVEAWRSLG 525 Query: 217 NVGI*WLTRLFNNILKQGMM 276 +G+ WLT FNNI + M Sbjct: 526 ELGVRWLTEFFNNITRSAKM 545 >gb|EYB99857.1| hypothetical protein Y032_0119g807 [Ancylostoma ceylanicum] Length = 982 Score = 71.6 bits (174), Expect = 2e-10 Identities = 35/80 (43%), Positives = 48/80 (60%) Frame = +1 Query: 37 YFQNLLKEKYPREEVEIN*FNIGMINKITNKGVEDTLKKMKSNKAVCPDNIPIEAWRTLG 216 YF++LL E++PR+ G + T V +KKMK+ KA PD IP+EAWR+LG Sbjct: 466 YFEHLLNEEFPRKPKAPAEPVAGPMQPWTADEVRKAIKKMKAGKATGPDGIPVEAWRSLG 525 Query: 217 NVGI*WLTRLFNNILKQGMM 276 +G+ WLT FNNI + M Sbjct: 526 ELGVRWLTEFFNNITRSAKM 545 >gb|EYB99710.1| hypothetical protein Y032_0120g898 [Ancylostoma ceylanicum] Length = 1331 Score = 71.6 bits (174), Expect = 2e-10 Identities = 35/80 (43%), Positives = 48/80 (60%) Frame = +1 Query: 37 YFQNLLKEKYPREEVEIN*FNIGMINKITNKGVEDTLKKMKSNKAVCPDNIPIEAWRTLG 216 YF++LL E++PR+ G + T V +KKMK+ KA PD IP+EAWR+LG Sbjct: 815 YFEHLLNEEFPRKPKAPAEPVAGPMQPWTADEVRKAIKKMKAGKATGPDGIPVEAWRSLG 874 Query: 217 NVGI*WLTRLFNNILKQGMM 276 +G+ WLT FNNI + M Sbjct: 875 ELGVRWLTEFFNNITRSAKM 894