BLASTX nr result
ID: Cornus23_contig00040569
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00040569 (326 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013754042.1| hypothetical protein AMSG_09689 [Thecamonas ... 64 3e-08 >ref|XP_013754042.1| hypothetical protein AMSG_09689 [Thecamonas trahens ATCC 50062] gi|906560786|gb|KNC54029.1| hypothetical protein AMSG_09689 [Thecamonas trahens ATCC 50062] Length = 190 Score = 64.3 bits (155), Expect = 3e-08 Identities = 35/98 (35%), Positives = 51/98 (52%), Gaps = 3/98 (3%) Frame = -3 Query: 312 TPPTVSEAYIADLTIHVQNGTHQLFGRGTEVRDQPAKKAVMQYIFSEDGHAEN-IYVLER 136 TPP++SE + A +TI V G G G +DQ A KAV + F H N +Y L R Sbjct: 19 TPPSISETFEAAVTIEVHKGNEHAIGEGRVAQDQSANKAVQFWEFENPQHKHNDVYELAR 78 Query: 135 YDLGDRYSVEGREK--CTKTKLTNATMPSQWAWLKNSE 28 YDLG Y+++ K C K K ++P + W+ ++ Sbjct: 79 YDLGFDYAIDSNNKTMCYK-KAVTGSLPGWFDWVSKAQ 115