BLASTX nr result
ID: Cornus23_contig00040470
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00040470 (363 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CEJ58192.1| hypothetical protein PMG11_06858 [Penicillium br... 65 2e-08 ref|XP_003295707.1| hypothetical protein PTT_02376 [Pyrenophora ... 65 2e-08 gb|KOC10221.1| putative mitochondrial solute carrier [Aspergillu... 64 3e-08 gb|KIW08193.1| hypothetical protein PV09_01124 [Verruconis gallo... 64 4e-08 emb|CRL24094.1| Mitochondrial substrate carrier [Penicillium cam... 64 6e-08 gb|KNG82681.1| putative mitochondrial solute carrier [Aspergillu... 62 2e-07 dbj|BAE55168.1| unnamed protein product [Aspergillus oryzae RIB40] 62 2e-07 gb|EIT79684.1| tricarboxylate carrier protein [Aspergillus oryza... 62 2e-07 ref|XP_001817170.2| hypothetical protein AOR_1_84174 [Aspergillu... 62 2e-07 ref|XP_007597430.1| mitochondrial carrier protein [Colletotrichu... 57 4e-06 emb|CCF40599.1| mitochondrial carrier protein [Colletotrichum hi... 57 5e-06 >emb|CEJ58192.1| hypothetical protein PMG11_06858 [Penicillium brasilianum] Length = 301 Score = 65.5 bits (158), Expect = 2e-08 Identities = 27/48 (56%), Positives = 38/48 (79%) Frame = -1 Query: 363 RGSFDCLQQIVARDGWRGLWRGTTPRLIRMSIASTLSFSIYEQVVRLT 220 RGS DC + +++++G LWRGTTPRL+R+S++ LSFSIYE VV+ T Sbjct: 238 RGSLDCFRSVISQEGISALWRGTTPRLVRLSVSGALSFSIYEAVVQWT 285 >ref|XP_003295707.1| hypothetical protein PTT_02376 [Pyrenophora teres f. teres 0-1] gi|311332795|gb|EFQ96197.1| hypothetical protein PTT_02376 [Pyrenophora teres f. teres 0-1] Length = 300 Score = 65.5 bits (158), Expect = 2e-08 Identities = 27/46 (58%), Positives = 39/46 (84%) Frame = -1 Query: 357 SFDCLQQIVARDGWRGLWRGTTPRLIRMSIASTLSFSIYEQVVRLT 220 S+DC +++V DG R LW+GTTPRLIR+S+A ++F++YE+VVRLT Sbjct: 238 SWDCAKKLVVNDGPRRLWKGTTPRLIRLSVAGAIAFTVYEEVVRLT 283 >gb|KOC10221.1| putative mitochondrial solute carrier [Aspergillus flavus AF70] Length = 294 Score = 64.3 bits (155), Expect = 3e-08 Identities = 29/48 (60%), Positives = 37/48 (77%) Frame = -1 Query: 363 RGSFDCLQQIVARDGWRGLWRGTTPRLIRMSIASTLSFSIYEQVVRLT 220 RGSF CL+ IV R+G LW GTTPRL R+SI+ +SF+IYE+VV+ T Sbjct: 242 RGSFHCLRSIVTREGTLALWNGTTPRLARLSISGAISFAIYERVVQWT 289 >gb|KIW08193.1| hypothetical protein PV09_01124 [Verruconis gallopava] Length = 196 Score = 63.9 bits (154), Expect = 4e-08 Identities = 25/51 (49%), Positives = 41/51 (80%) Frame = -1 Query: 360 GSFDCLQQIVARDGWRGLWRGTTPRLIRMSIASTLSFSIYEQVVRLTRQQT 208 GS+DC++++V+R G R LW+GTTPRL+R+S++ +SFS+YE++V + T Sbjct: 135 GSWDCVRKMVSRGGVRSLWKGTTPRLVRLSVSGAISFSVYERIVAFMQNFT 185 >emb|CRL24094.1| Mitochondrial substrate carrier [Penicillium camemberti] Length = 288 Score = 63.5 bits (153), Expect = 6e-08 Identities = 24/48 (50%), Positives = 37/48 (77%) Frame = -1 Query: 363 RGSFDCLQQIVARDGWRGLWRGTTPRLIRMSIASTLSFSIYEQVVRLT 220 RGS DCL+ +++++G WRGTTPRL+R+S++ LSF++YE V+ T Sbjct: 237 RGSLDCLRSVISQEGVSAFWRGTTPRLVRLSVSGALSFTVYESVIEWT 284 >gb|KNG82681.1| putative mitochondrial solute carrier [Aspergillus nomius NRRL 13137] Length = 294 Score = 62.0 bits (149), Expect = 2e-07 Identities = 28/48 (58%), Positives = 37/48 (77%) Frame = -1 Query: 363 RGSFDCLQQIVARDGWRGLWRGTTPRLIRMSIASTLSFSIYEQVVRLT 220 RGS CLQ IV+ +G LW+GTTPRL R+SI+ +SF+IYE+VV+ T Sbjct: 242 RGSVHCLQSIVSTEGTLALWKGTTPRLARLSISGAISFAIYERVVQWT 289 >dbj|BAE55168.1| unnamed protein product [Aspergillus oryzae RIB40] Length = 297 Score = 62.0 bits (149), Expect = 2e-07 Identities = 28/48 (58%), Positives = 36/48 (75%) Frame = -1 Query: 363 RGSFDCLQQIVARDGWRGLWRGTTPRLIRMSIASTLSFSIYEQVVRLT 220 RGSF CL+ IV +G LW GTTPRL R+SI+ +SF+IYE+VV+ T Sbjct: 245 RGSFHCLRSIVTTEGTLALWNGTTPRLARLSISGAISFAIYERVVQWT 292 >gb|EIT79684.1| tricarboxylate carrier protein [Aspergillus oryzae 3.042] gi|635506424|gb|KDE78465.1| tricarboxylate/dicarboxylate carrier protein [Aspergillus oryzae 100-8] Length = 297 Score = 62.0 bits (149), Expect = 2e-07 Identities = 28/48 (58%), Positives = 36/48 (75%) Frame = -1 Query: 363 RGSFDCLQQIVARDGWRGLWRGTTPRLIRMSIASTLSFSIYEQVVRLT 220 RGSF CL+ IV +G LW GTTPRL R+SI+ +SF+IYE+VV+ T Sbjct: 245 RGSFHCLRSIVTTEGTLALWNGTTPRLTRLSISGAISFAIYERVVQWT 292 >ref|XP_001817170.2| hypothetical protein AOR_1_84174 [Aspergillus oryzae RIB40] Length = 292 Score = 62.0 bits (149), Expect = 2e-07 Identities = 28/48 (58%), Positives = 36/48 (75%) Frame = -1 Query: 363 RGSFDCLQQIVARDGWRGLWRGTTPRLIRMSIASTLSFSIYEQVVRLT 220 RGSF CL+ IV +G LW GTTPRL R+SI+ +SF+IYE+VV+ T Sbjct: 240 RGSFHCLRSIVTTEGTLALWNGTTPRLARLSISGAISFAIYERVVQWT 287 >ref|XP_007597430.1| mitochondrial carrier protein [Colletotrichum fioriniae PJ7] gi|588897684|gb|EXF78915.1| mitochondrial carrier protein [Colletotrichum fioriniae PJ7] Length = 343 Score = 57.4 bits (137), Expect = 4e-06 Identities = 24/57 (42%), Positives = 39/57 (68%) Frame = -1 Query: 360 GSFDCLQQIVARDGWRGLWRGTTPRLIRMSIASTLSFSIYEQVVRLTRQQTHEQLVS 190 G DC +I+ DG WRGT+PRL+R++++S ++F++Y+QVVRL + E+ S Sbjct: 282 GMVDCAARILRSDGVFAFWRGTSPRLVRLTLSSGITFTVYDQVVRLMKSSQTERKAS 338 >emb|CCF40599.1| mitochondrial carrier protein [Colletotrichum higginsianum] Length = 149 Score = 57.0 bits (136), Expect = 5e-06 Identities = 22/49 (44%), Positives = 36/49 (73%) Frame = -1 Query: 363 RGSFDCLQQIVARDGWRGLWRGTTPRLIRMSIASTLSFSIYEQVVRLTR 217 +G DC Q + DG WRGT+PRL+R++++S ++F++Y+QVVRL + Sbjct: 87 KGMLDCAAQTLREDGVLAFWRGTSPRLVRLTLSSGITFTVYDQVVRLIK 135