BLASTX nr result
ID: Cornus23_contig00040438
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00040438 (299 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009592088.1| PREDICTED: uncharacterized protein LOC104088... 63 1e-07 >ref|XP_009592088.1| PREDICTED: uncharacterized protein LOC104088996 [Nicotiana tomentosiformis] Length = 253 Score = 62.8 bits (151), Expect = 1e-07 Identities = 35/96 (36%), Positives = 50/96 (52%), Gaps = 1/96 (1%) Frame = +1 Query: 13 SFVDVARLPQLFLGGSV-RSACPTRGPSLYMDELSTRR*RGFLQSCLVGCFDKEVGSKEI 189 SF+ P L LGG R + P + E T R +GFL+S L+G F K VGS E Sbjct: 22 SFIKAVSWPALELGGRCHRKLDVGQEPHFSLSEEYTLRRKGFLESSLIGSFSKWVGSPEA 81 Query: 190 IAEWARKTWRANAGVVVTSLPDSLLLFRFPSPAEAN 297 + WA + W G+ ++ L D+ LFRF ++A+ Sbjct: 82 VRNWAAEAWNVKDGLKISQLGDTQYLFRFVDKSQAS 117