BLASTX nr result
ID: Cornus23_contig00040191
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00040191 (724 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003838448.1| predicted protein [Leptosphaeria maculans JN... 66 2e-08 >ref|XP_003838448.1| predicted protein [Leptosphaeria maculans JN3] gi|312215016|emb|CBX94969.1| predicted protein [Leptosphaeria maculans JN3] Length = 103 Score = 66.2 bits (160), Expect = 2e-08 Identities = 34/55 (61%), Positives = 36/55 (65%) Frame = -2 Query: 708 MRLSIRHLNSLAEPVHSVRFCTTNGKCGPAVLVTYWTAVAPTRSALRIVSSITQY 544 MRLSIRHLNS A P+H R TTNGKCG AVL TYWTA RI S+T Y Sbjct: 1 MRLSIRHLNSHAGPLHLTRLRTTNGKCGTAVLATYWTASLLLDQFTRIQLSVTPY 55