BLASTX nr result
ID: Cornus23_contig00040175
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00040175 (369 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHJ35380.1| putative microtubule-associated protein [Erysiphe... 58 2e-06 >gb|KHJ35380.1| putative microtubule-associated protein [Erysiphe necator] Length = 157 Score = 58.2 bits (139), Expect = 2e-06 Identities = 34/77 (44%), Positives = 41/77 (53%), Gaps = 7/77 (9%) Frame = -1 Query: 213 SPLSSSDVPFAFKLPEGLTPDCLDTIPVLSSLICRL-------XXXXXXXXXXXXXXXXX 55 S +SSD+P FKLPEGL+P+ +DT+PVLSSL+ R Sbjct: 6 STSTSSDIPSVFKLPEGLSPNSIDTVPVLSSLLSRFQTSQLNSSISASGLIRSTASPSQL 65 Query: 54 XNGTGPLTFKDIPPATD 4 GTGPLT KDI ATD Sbjct: 66 LVGTGPLTDKDITSATD 82