BLASTX nr result
ID: Cornus23_contig00040166
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00040166 (519 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010664915.1| PREDICTED: putative pentatricopeptide repeat... 57 4e-06 >ref|XP_010664915.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Vitis vinifera] Length = 536 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/51 (50%), Positives = 37/51 (72%), Gaps = 1/51 (1%) Frame = -2 Query: 518 IIQKLCACGRVKEALKFLNDMIKDGHLVFFTKWKVLF-KLFDGVEHGIAIG 369 I++ LC GR+KEA +LN+MIK GH++ FT+WK LF F G +HG ++G Sbjct: 485 IVRGLCDGGRLKEAHMYLNEMIKHGHMISFTRWKALFYSTFVGNKHGFSLG 535