BLASTX nr result
ID: Cornus23_contig00040133
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00040133 (278 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008245407.1| PREDICTED: LOW QUALITY PROTEIN: callose synt... 180 3e-43 ref|XP_008245396.1| PREDICTED: callose synthase 2-like [Prunus m... 180 3e-43 ref|XP_007220574.1| hypothetical protein PRUPE_ppa000074mg [Prun... 180 3e-43 ref|XP_012093237.1| PREDICTED: callose synthase 3 [Jatropha curcas] 180 4e-43 ref|XP_011080223.1| PREDICTED: callose synthase 3-like [Sesamum ... 180 4e-43 ref|XP_010519718.1| PREDICTED: callose synthase 3 [Tarenaya hass... 180 4e-43 gb|KDP44404.1| hypothetical protein JCGZ_19419 [Jatropha curcas] 180 4e-43 ref|XP_011083139.1| PREDICTED: callose synthase 3 [Sesamum indicum] 179 6e-43 ref|XP_002304888.2| GLUCAN SYNTHASE-LIKE 9 family protein [Popul... 179 7e-43 ref|XP_009354674.1| PREDICTED: callose synthase 1-like isoform X... 179 9e-43 ref|XP_008356756.1| PREDICTED: callose synthase 1-like [Malus do... 179 9e-43 ref|XP_008346921.1| PREDICTED: callose synthase 3-like [Malus do... 179 9e-43 ref|XP_011002293.1| PREDICTED: callose synthase 2-like [Populus ... 178 1e-42 emb|CAZ15552.1| 1,3-beta-glucan synthase [Malus domestica] 178 1e-42 ref|XP_012828960.1| PREDICTED: callose synthase 3 [Erythranthe g... 178 1e-42 ref|XP_013668036.1| PREDICTED: callose synthase 3-like [Brassica... 178 2e-42 ref|XP_013667978.1| PREDICTED: callose synthase 3-like [Brassica... 178 2e-42 ref|XP_013679440.1| PREDICTED: callose synthase 3-like [Brassica... 178 2e-42 ref|XP_013611070.1| PREDICTED: callose synthase 3-like [Brassica... 178 2e-42 ref|XP_013619470.1| PREDICTED: callose synthase 3 [Brassica oler... 178 2e-42 >ref|XP_008245407.1| PREDICTED: LOW QUALITY PROTEIN: callose synthase 1-like, partial [Prunus mume] Length = 1503 Score = 180 bits (457), Expect = 3e-43 Identities = 85/92 (92%), Positives = 90/92 (97%) Frame = -1 Query: 278 HMTLRDIVVCILAFMPTGWGLLQIAQACKPLVQRAGFWGSVRTLARGYEIVMGLFLFTPV 99 HMTLRD+VVCILAFMPTGWGLL IAQACKPL+Q+AGFWGSV+TLARGYEI+MGL LFTPV Sbjct: 1396 HMTLRDVVVCILAFMPTGWGLLLIAQACKPLIQQAGFWGSVQTLARGYEIIMGLLLFTPV 1455 Query: 98 AFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL 3 AFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL Sbjct: 1456 AFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL 1487 >ref|XP_008245396.1| PREDICTED: callose synthase 2-like [Prunus mume] Length = 1953 Score = 180 bits (457), Expect = 3e-43 Identities = 85/92 (92%), Positives = 90/92 (97%) Frame = -1 Query: 278 HMTLRDIVVCILAFMPTGWGLLQIAQACKPLVQRAGFWGSVRTLARGYEIVMGLFLFTPV 99 HMTLRD+VVCILAFMPTGWGLL IAQACKPL+Q+AGFWGSV+TLARGYEI+MGL LFTPV Sbjct: 1846 HMTLRDVVVCILAFMPTGWGLLLIAQACKPLIQQAGFWGSVQTLARGYEIIMGLLLFTPV 1905 Query: 98 AFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL 3 AFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL Sbjct: 1906 AFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL 1937 >ref|XP_007220574.1| hypothetical protein PRUPE_ppa000074mg [Prunus persica] gi|462417036|gb|EMJ21773.1| hypothetical protein PRUPE_ppa000074mg [Prunus persica] Length = 1953 Score = 180 bits (457), Expect = 3e-43 Identities = 85/92 (92%), Positives = 90/92 (97%) Frame = -1 Query: 278 HMTLRDIVVCILAFMPTGWGLLQIAQACKPLVQRAGFWGSVRTLARGYEIVMGLFLFTPV 99 HMTLRD+VVCILAFMPTGWGLL IAQACKPL+Q+AGFWGSV+TLARGYEI+MGL LFTPV Sbjct: 1846 HMTLRDVVVCILAFMPTGWGLLLIAQACKPLIQQAGFWGSVQTLARGYEIIMGLLLFTPV 1905 Query: 98 AFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL 3 AFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL Sbjct: 1906 AFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL 1937 >ref|XP_012093237.1| PREDICTED: callose synthase 3 [Jatropha curcas] Length = 1950 Score = 180 bits (456), Expect = 4e-43 Identities = 86/92 (93%), Positives = 90/92 (97%) Frame = -1 Query: 278 HMTLRDIVVCILAFMPTGWGLLQIAQACKPLVQRAGFWGSVRTLARGYEIVMGLFLFTPV 99 HMT++DIVVCILAFMPTGWG+L IAQACKP+VQRAGFWGSVRTLARGYEIVMGL LFTPV Sbjct: 1846 HMTVQDIVVCILAFMPTGWGMLLIAQACKPVVQRAGFWGSVRTLARGYEIVMGLLLFTPV 1905 Query: 98 AFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL 3 AFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL Sbjct: 1906 AFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL 1937 >ref|XP_011080223.1| PREDICTED: callose synthase 3-like [Sesamum indicum] gi|747067050|ref|XP_011080224.1| PREDICTED: callose synthase 3-like [Sesamum indicum] Length = 1948 Score = 180 bits (456), Expect = 4e-43 Identities = 87/92 (94%), Positives = 89/92 (96%) Frame = -1 Query: 278 HMTLRDIVVCILAFMPTGWGLLQIAQACKPLVQRAGFWGSVRTLARGYEIVMGLFLFTPV 99 HMT RDIVVCILAFMPTGWGLL IAQACKP+VQ+AGFWGSVRTLARGYEIVMGL LFTPV Sbjct: 1844 HMTPRDIVVCILAFMPTGWGLLLIAQACKPIVQKAGFWGSVRTLARGYEIVMGLLLFTPV 1903 Query: 98 AFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL 3 AFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL Sbjct: 1904 AFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL 1935 >ref|XP_010519718.1| PREDICTED: callose synthase 3 [Tarenaya hassleriana] Length = 1957 Score = 180 bits (456), Expect = 4e-43 Identities = 85/92 (92%), Positives = 90/92 (97%) Frame = -1 Query: 278 HMTLRDIVVCILAFMPTGWGLLQIAQACKPLVQRAGFWGSVRTLARGYEIVMGLFLFTPV 99 HMT++DI+VCILAF PTGWG+L IAQACKP+VQRAGFWGSVRTLARGYEIVMGLFLFTPV Sbjct: 1853 HMTIQDIIVCILAFTPTGWGMLLIAQACKPVVQRAGFWGSVRTLARGYEIVMGLFLFTPV 1912 Query: 98 AFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL 3 AFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL Sbjct: 1913 AFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL 1944 >gb|KDP44404.1| hypothetical protein JCGZ_19419 [Jatropha curcas] Length = 1597 Score = 180 bits (456), Expect = 4e-43 Identities = 86/92 (93%), Positives = 90/92 (97%) Frame = -1 Query: 278 HMTLRDIVVCILAFMPTGWGLLQIAQACKPLVQRAGFWGSVRTLARGYEIVMGLFLFTPV 99 HMT++DIVVCILAFMPTGWG+L IAQACKP+VQRAGFWGSVRTLARGYEIVMGL LFTPV Sbjct: 1493 HMTVQDIVVCILAFMPTGWGMLLIAQACKPVVQRAGFWGSVRTLARGYEIVMGLLLFTPV 1552 Query: 98 AFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL 3 AFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL Sbjct: 1553 AFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL 1584 >ref|XP_011083139.1| PREDICTED: callose synthase 3 [Sesamum indicum] Length = 1948 Score = 179 bits (455), Expect = 6e-43 Identities = 87/92 (94%), Positives = 89/92 (96%) Frame = -1 Query: 278 HMTLRDIVVCILAFMPTGWGLLQIAQACKPLVQRAGFWGSVRTLARGYEIVMGLFLFTPV 99 HMT RDIVVCILAFMPTGWGLL IAQACKP+VQ+AGFWGSVRTLARGYEIVMGL LFTPV Sbjct: 1844 HMTPRDIVVCILAFMPTGWGLLLIAQACKPVVQKAGFWGSVRTLARGYEIVMGLLLFTPV 1903 Query: 98 AFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL 3 AFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL Sbjct: 1904 AFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL 1935 >ref|XP_002304888.2| GLUCAN SYNTHASE-LIKE 9 family protein [Populus trichocarpa] gi|550343723|gb|EEE79867.2| GLUCAN SYNTHASE-LIKE 9 family protein [Populus trichocarpa] Length = 1852 Score = 179 bits (454), Expect = 7e-43 Identities = 84/92 (91%), Positives = 90/92 (97%) Frame = -1 Query: 278 HMTLRDIVVCILAFMPTGWGLLQIAQACKPLVQRAGFWGSVRTLARGYEIVMGLFLFTPV 99 HMT++D++VCILAFMPTGWG+L IAQACKP+VQRAGFWGSVRTLARGYEIVMGL LFTPV Sbjct: 1748 HMTVQDVIVCILAFMPTGWGMLLIAQACKPVVQRAGFWGSVRTLARGYEIVMGLLLFTPV 1807 Query: 98 AFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL 3 AFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL Sbjct: 1808 AFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL 1839 >ref|XP_009354674.1| PREDICTED: callose synthase 1-like isoform X1 [Pyrus x bretschneideri] gi|694327635|ref|XP_009354675.1| PREDICTED: callose synthase 1-like isoform X2 [Pyrus x bretschneideri] Length = 1952 Score = 179 bits (453), Expect = 9e-43 Identities = 83/92 (90%), Positives = 90/92 (97%) Frame = -1 Query: 278 HMTLRDIVVCILAFMPTGWGLLQIAQACKPLVQRAGFWGSVRTLARGYEIVMGLFLFTPV 99 HMTLRD++VCILAFMPTGWGLL IAQACKP+++RAGFWGSV+TLARGYEI+MGL LFTPV Sbjct: 1847 HMTLRDVIVCILAFMPTGWGLLLIAQACKPVIKRAGFWGSVQTLARGYEIIMGLLLFTPV 1906 Query: 98 AFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL 3 AFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL Sbjct: 1907 AFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL 1938 >ref|XP_008356756.1| PREDICTED: callose synthase 1-like [Malus domestica] Length = 1325 Score = 179 bits (453), Expect = 9e-43 Identities = 84/92 (91%), Positives = 89/92 (96%) Frame = -1 Query: 278 HMTLRDIVVCILAFMPTGWGLLQIAQACKPLVQRAGFWGSVRTLARGYEIVMGLFLFTPV 99 HMTLRD+VVCILAFMPTGWGLL IAQACKP+++RAGFWGSV TLARGYEI+MGL LFTPV Sbjct: 1220 HMTLRDVVVCILAFMPTGWGLLLIAQACKPVIKRAGFWGSVETLARGYEIIMGLLLFTPV 1279 Query: 98 AFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL 3 AFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL Sbjct: 1280 AFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL 1311 >ref|XP_008346921.1| PREDICTED: callose synthase 3-like [Malus domestica] Length = 600 Score = 179 bits (453), Expect = 9e-43 Identities = 84/92 (91%), Positives = 89/92 (96%) Frame = -1 Query: 278 HMTLRDIVVCILAFMPTGWGLLQIAQACKPLVQRAGFWGSVRTLARGYEIVMGLFLFTPV 99 HMTLRD+VVCILAFMPTGWGLL IAQACKP+++RAGFWGSV TLARGYEI+MGL LFTPV Sbjct: 495 HMTLRDVVVCILAFMPTGWGLLLIAQACKPVIKRAGFWGSVETLARGYEIIMGLLLFTPV 554 Query: 98 AFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL 3 AFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL Sbjct: 555 AFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL 586 >ref|XP_011002293.1| PREDICTED: callose synthase 2-like [Populus euphratica] gi|743916640|ref|XP_011002295.1| PREDICTED: callose synthase 2-like [Populus euphratica] gi|743916642|ref|XP_011002296.1| PREDICTED: callose synthase 2-like [Populus euphratica] Length = 1949 Score = 178 bits (452), Expect = 1e-42 Identities = 84/92 (91%), Positives = 89/92 (96%) Frame = -1 Query: 278 HMTLRDIVVCILAFMPTGWGLLQIAQACKPLVQRAGFWGSVRTLARGYEIVMGLFLFTPV 99 HMT+RDI+VCILAF+P+GWGLL IAQACKPL+Q AGFWGSVRTLARGYEIVMGL LFTPV Sbjct: 1845 HMTIRDIIVCILAFLPSGWGLLLIAQACKPLIQHAGFWGSVRTLARGYEIVMGLLLFTPV 1904 Query: 98 AFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL 3 AFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL Sbjct: 1905 AFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL 1936 >emb|CAZ15552.1| 1,3-beta-glucan synthase [Malus domestica] Length = 238 Score = 178 bits (452), Expect = 1e-42 Identities = 83/92 (90%), Positives = 89/92 (96%) Frame = -1 Query: 278 HMTLRDIVVCILAFMPTGWGLLQIAQACKPLVQRAGFWGSVRTLARGYEIVMGLFLFTPV 99 HMTLRD++VCILAFMPTGWGLL IAQACKP+++RAGFWGSV TLARGYEI+MGL LFTPV Sbjct: 133 HMTLRDVIVCILAFMPTGWGLLLIAQACKPVIKRAGFWGSVETLARGYEIIMGLLLFTPV 192 Query: 98 AFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL 3 AFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL Sbjct: 193 AFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL 224 >ref|XP_012828960.1| PREDICTED: callose synthase 3 [Erythranthe guttatus] gi|848932069|ref|XP_012828961.1| PREDICTED: callose synthase 3 [Erythranthe guttatus] gi|604297880|gb|EYU17999.1| hypothetical protein MIMGU_mgv1a000067mg [Erythranthe guttata] Length = 1948 Score = 178 bits (452), Expect = 1e-42 Identities = 86/92 (93%), Positives = 89/92 (96%) Frame = -1 Query: 278 HMTLRDIVVCILAFMPTGWGLLQIAQACKPLVQRAGFWGSVRTLARGYEIVMGLFLFTPV 99 HMT RDI+VCILAFMPTGWGLL IAQACKP+VQ+AGFWGSVRTLARGYEIVMGL LFTPV Sbjct: 1844 HMTPRDILVCILAFMPTGWGLLLIAQACKPVVQKAGFWGSVRTLARGYEIVMGLLLFTPV 1903 Query: 98 AFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL 3 AFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL Sbjct: 1904 AFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL 1935 >ref|XP_013668036.1| PREDICTED: callose synthase 3-like [Brassica napus] gi|923730976|ref|XP_013668037.1| PREDICTED: callose synthase 3-like [Brassica napus] gi|923730978|ref|XP_013668038.1| PREDICTED: callose synthase 3-like [Brassica napus] Length = 1955 Score = 178 bits (451), Expect = 2e-42 Identities = 84/92 (91%), Positives = 89/92 (96%) Frame = -1 Query: 278 HMTLRDIVVCILAFMPTGWGLLQIAQACKPLVQRAGFWGSVRTLARGYEIVMGLFLFTPV 99 HMT++DI+VCILAFMPTGWG+L IAQACKP+V RAGFWGSVRTLARGYEIVMGL LFTPV Sbjct: 1851 HMTIQDIIVCILAFMPTGWGMLLIAQACKPVVHRAGFWGSVRTLARGYEIVMGLLLFTPV 1910 Query: 98 AFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL 3 AFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL Sbjct: 1911 AFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL 1942 >ref|XP_013667978.1| PREDICTED: callose synthase 3-like [Brassica napus] gi|923730803|ref|XP_013667979.1| PREDICTED: callose synthase 3-like [Brassica napus] gi|923730806|ref|XP_013667980.1| PREDICTED: callose synthase 3-like [Brassica napus] Length = 1955 Score = 178 bits (451), Expect = 2e-42 Identities = 84/92 (91%), Positives = 89/92 (96%) Frame = -1 Query: 278 HMTLRDIVVCILAFMPTGWGLLQIAQACKPLVQRAGFWGSVRTLARGYEIVMGLFLFTPV 99 HMT++DI+VCILAFMPTGWG+L IAQACKP+V RAGFWGSVRTLARGYEIVMGL LFTPV Sbjct: 1851 HMTIQDIIVCILAFMPTGWGMLLIAQACKPVVHRAGFWGSVRTLARGYEIVMGLLLFTPV 1910 Query: 98 AFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL 3 AFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL Sbjct: 1911 AFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL 1942 >ref|XP_013679440.1| PREDICTED: callose synthase 3-like [Brassica napus] Length = 1749 Score = 178 bits (451), Expect = 2e-42 Identities = 84/92 (91%), Positives = 89/92 (96%) Frame = -1 Query: 278 HMTLRDIVVCILAFMPTGWGLLQIAQACKPLVQRAGFWGSVRTLARGYEIVMGLFLFTPV 99 HMT++DI+VCILAFMPTGWG+L IAQACKP+V RAGFWGSVRTLARGYEIVMGL LFTPV Sbjct: 1645 HMTIQDIIVCILAFMPTGWGMLLIAQACKPVVHRAGFWGSVRTLARGYEIVMGLLLFTPV 1704 Query: 98 AFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL 3 AFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL Sbjct: 1705 AFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL 1736 >ref|XP_013611070.1| PREDICTED: callose synthase 3-like [Brassica oleracea var. oleracea] gi|922565612|ref|XP_013611071.1| PREDICTED: callose synthase 3-like [Brassica oleracea var. oleracea] gi|922565614|ref|XP_013611072.1| PREDICTED: callose synthase 3-like [Brassica oleracea var. oleracea] gi|922565616|ref|XP_013611073.1| PREDICTED: callose synthase 3-like [Brassica oleracea var. oleracea] Length = 1956 Score = 178 bits (451), Expect = 2e-42 Identities = 84/92 (91%), Positives = 89/92 (96%) Frame = -1 Query: 278 HMTLRDIVVCILAFMPTGWGLLQIAQACKPLVQRAGFWGSVRTLARGYEIVMGLFLFTPV 99 HMT++DI+VCILAFMPTGWG+L IAQACKP+V RAGFWGSVRTLARGYEIVMGL LFTPV Sbjct: 1852 HMTIQDIIVCILAFMPTGWGMLLIAQACKPVVHRAGFWGSVRTLARGYEIVMGLLLFTPV 1911 Query: 98 AFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL 3 AFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL Sbjct: 1912 AFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL 1943 >ref|XP_013619470.1| PREDICTED: callose synthase 3 [Brassica oleracea var. oleracea] gi|923859267|ref|XP_013706047.1| PREDICTED: callose synthase 3 [Brassica napus] Length = 1953 Score = 178 bits (451), Expect = 2e-42 Identities = 84/92 (91%), Positives = 89/92 (96%) Frame = -1 Query: 278 HMTLRDIVVCILAFMPTGWGLLQIAQACKPLVQRAGFWGSVRTLARGYEIVMGLFLFTPV 99 HMT++DI+VCILAFMPTGWG+L IAQACKP+V RAGFWGSVRTLARGYEIVMGL LFTPV Sbjct: 1849 HMTIQDIIVCILAFMPTGWGMLLIAQACKPVVHRAGFWGSVRTLARGYEIVMGLLLFTPV 1908 Query: 98 AFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL 3 AFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL Sbjct: 1909 AFLAWFPFVSEFQTRMLFNQAFSRGLQISRIL 1940