BLASTX nr result
ID: Cornus23_contig00039810
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00039810 (384 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012672094.1| PREDICTED: 60S ribosomal protein L17 isoform... 132 1e-28 ref|XP_003453655.1| PREDICTED: 60S ribosomal protein L17 [Oreoch... 132 1e-28 gb|AAS49553.1| ribosomal protein L17 [Latimeria chalumnae] 131 2e-28 gb|KQL97082.1| ribosomal protein L17 [Alligator mississippiensis] 131 2e-28 sp|Q9CPR4.3|RL17_MOUSE RecName: Full=60S ribosomal protein L17 g... 131 2e-28 ref|XP_006903542.1| PREDICTED: 60S ribosomal protein L17-like [E... 131 2e-28 ref|XP_006902201.1| PREDICTED: 60S ribosomal protein L17-like [E... 131 2e-28 ref|XP_006884241.1| PREDICTED: 60S ribosomal protein L17-like [E... 131 2e-28 ref|XP_006739155.1| PREDICTED: 60S ribosomal protein L17-like [L... 131 2e-28 ref|XP_006737075.1| PREDICTED: 60S ribosomal protein L17-like [L... 131 2e-28 dbj|BAC56547.1| similar to ribosomal protein L17 [Bos taurus] 131 2e-28 ref|NP_000976.1| 60S ribosomal protein L17 isoform a [Homo sapie... 131 2e-28 dbj|BAC56511.1| similar to ribosomal protein L17 [Bos taurus] 131 2e-28 ref|XP_012914337.1| PREDICTED: 60S ribosomal protein L17-like is... 131 2e-28 ref|XP_012914336.1| PREDICTED: 60S ribosomal protein L17-like is... 131 2e-28 ref|XP_012874450.1| PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma... 131 2e-28 ref|XP_004703038.2| PREDICTED: 60S ribosomal protein L17 [Echino... 131 2e-28 ref|XP_012786948.1| PREDICTED: 60S ribosomal protein L17 isoform... 131 2e-28 ref|XP_012625355.1| PREDICTED: 60S ribosomal protein L17 [Microc... 131 2e-28 ref|XP_012498116.1| PREDICTED: 60S ribosomal protein L17 [Propit... 131 2e-28 >ref|XP_012672094.1| PREDICTED: 60S ribosomal protein L17 isoform X1 [Clupea harengus] gi|831272019|ref|XP_012672102.1| PREDICTED: 60S ribosomal protein L17 isoform X1 [Clupea harengus] gi|831272021|ref|XP_012672109.1| PREDICTED: 60S ribosomal protein L17 isoform X2 [Clupea harengus] Length = 184 Score = 132 bits (331), Expect = 1e-28 Identities = 62/84 (73%), Positives = 69/84 (82%) Frame = -2 Query: 383 CAQGNGQGHPQARWPKKSAEVLLDLLSNAQSNAEVKELNLDQLVIRHIQVNEAPKQRRRT 204 CAQ G Q RWPKKSAE LL +L NA+SNAE+K L++D LVI HIQVN+APK RRRT Sbjct: 70 CAQAKQHGWTQGRWPKKSAEFLLHMLKNAESNAELKGLDVDSLVIEHIQVNKAPKMRRRT 129 Query: 203 YRAHGRINPYMSSPCHIELFLTEK 132 YRAHGRINPYMSSPCHIE+ LTEK Sbjct: 130 YRAHGRINPYMSSPCHIEMILTEK 153 >ref|XP_003453655.1| PREDICTED: 60S ribosomal protein L17 [Oreochromis niloticus] gi|499022286|ref|XP_004561913.1| PREDICTED: 60S ribosomal protein L17 [Maylandia zebra] gi|548473902|ref|XP_005748461.1| PREDICTED: 60S ribosomal protein L17 [Pundamilia nyererei] gi|554870238|ref|XP_005945094.1| PREDICTED: 60S ribosomal protein L17 [Haplochromis burtoni] gi|583973662|ref|XP_006782230.1| PREDICTED: 60S ribosomal protein L17-like [Neolamprologus brichardi] Length = 184 Score = 132 bits (331), Expect = 1e-28 Identities = 62/84 (73%), Positives = 69/84 (82%) Frame = -2 Query: 383 CAQGNGQGHPQARWPKKSAEVLLDLLSNAQSNAEVKELNLDQLVIRHIQVNEAPKQRRRT 204 CAQ G Q RWPKKSAE LL +L NA+SNAE+K L++D LVI HIQVN+APK RRRT Sbjct: 70 CAQAKQHGWTQGRWPKKSAEFLLHMLKNAESNAELKGLDVDSLVIEHIQVNKAPKMRRRT 129 Query: 203 YRAHGRINPYMSSPCHIELFLTEK 132 YRAHGRINPYMSSPCHIE+ LTEK Sbjct: 130 YRAHGRINPYMSSPCHIEMILTEK 153 >gb|AAS49553.1| ribosomal protein L17 [Latimeria chalumnae] Length = 157 Score = 131 bits (330), Expect = 2e-28 Identities = 62/84 (73%), Positives = 69/84 (82%) Frame = -2 Query: 383 CAQGNGQGHPQARWPKKSAEVLLDLLSNAQSNAEVKELNLDQLVIRHIQVNEAPKQRRRT 204 CAQ G Q RWPKKSAE LL +L NA+SNAE+K L++D LVI HIQVN+APK RRRT Sbjct: 61 CAQAKQFGRTQGRWPKKSAEFLLHMLKNAESNAELKGLDVDSLVIEHIQVNKAPKMRRRT 120 Query: 203 YRAHGRINPYMSSPCHIELFLTEK 132 YRAHGRINPYMSSPCHIE+ LTEK Sbjct: 121 YRAHGRINPYMSSPCHIEMILTEK 144 >gb|KQL97082.1| ribosomal protein L17 [Alligator mississippiensis] Length = 226 Score = 131 bits (329), Expect = 2e-28 Identities = 62/84 (73%), Positives = 69/84 (82%) Frame = -2 Query: 383 CAQGNGQGHPQARWPKKSAEVLLDLLSNAQSNAEVKELNLDQLVIRHIQVNEAPKQRRRT 204 CAQ G Q RWPKKSAE LL +L NA+SNAE+K L++D LVI HIQVN+APK RRRT Sbjct: 70 CAQAKQWGWTQGRWPKKSAEFLLHMLKNAESNAELKGLDVDSLVIEHIQVNKAPKMRRRT 129 Query: 203 YRAHGRINPYMSSPCHIELFLTEK 132 YRAHGRINPYMSSPCHIE+ LTEK Sbjct: 130 YRAHGRINPYMSSPCHIEMILTEK 153 >sp|Q9CPR4.3|RL17_MOUSE RecName: Full=60S ribosomal protein L17 gi|12847061|dbj|BAB27423.1| unnamed protein product [Mus musculus] gi|12847063|dbj|BAB27424.1| unnamed protein product [Mus musculus] Length = 184 Score = 131 bits (329), Expect = 2e-28 Identities = 62/84 (73%), Positives = 69/84 (82%) Frame = -2 Query: 383 CAQGNGQGHPQARWPKKSAEVLLDLLSNAQSNAEVKELNLDQLVIRHIQVNEAPKQRRRT 204 CAQ G Q RWPKKSAE LL +L NA+SNAE+K L++D LVI HIQVN+APK RRRT Sbjct: 70 CAQAKQWGWTQGRWPKKSAEFLLHMLKNAESNAELKGLDVDSLVIEHIQVNKAPKMRRRT 129 Query: 203 YRAHGRINPYMSSPCHIELFLTEK 132 YRAHGRINPYMSSPCHIE+ LTEK Sbjct: 130 YRAHGRINPYMSSPCHIEMILTEK 153 >ref|XP_006903542.1| PREDICTED: 60S ribosomal protein L17-like [Elephantulus edwardii] Length = 184 Score = 131 bits (329), Expect = 2e-28 Identities = 62/84 (73%), Positives = 69/84 (82%) Frame = -2 Query: 383 CAQGNGQGHPQARWPKKSAEVLLDLLSNAQSNAEVKELNLDQLVIRHIQVNEAPKQRRRT 204 CAQ G Q RWPKKSAE LL +L NA+SNAE+K L++D LVI HIQVN+APK RRRT Sbjct: 70 CAQAKQWGWTQGRWPKKSAEFLLHMLKNAESNAELKGLDVDSLVIEHIQVNKAPKMRRRT 129 Query: 203 YRAHGRINPYMSSPCHIELFLTEK 132 YRAHGRINPYMSSPCHIE+ LTEK Sbjct: 130 YRAHGRINPYMSSPCHIEMILTEK 153 >ref|XP_006902201.1| PREDICTED: 60S ribosomal protein L17-like [Elephantulus edwardii] Length = 181 Score = 131 bits (329), Expect = 2e-28 Identities = 62/84 (73%), Positives = 69/84 (82%) Frame = -2 Query: 383 CAQGNGQGHPQARWPKKSAEVLLDLLSNAQSNAEVKELNLDQLVIRHIQVNEAPKQRRRT 204 CAQ G Q RWPKKSAE LL +L NA+SNAE+K L++D LVI HIQVN+APK RRRT Sbjct: 70 CAQAKQWGWTQGRWPKKSAEFLLHMLKNAESNAELKGLDVDSLVIEHIQVNKAPKMRRRT 129 Query: 203 YRAHGRINPYMSSPCHIELFLTEK 132 YRAHGRINPYMSSPCHIE+ LTEK Sbjct: 130 YRAHGRINPYMSSPCHIEMILTEK 153 >ref|XP_006884241.1| PREDICTED: 60S ribosomal protein L17-like [Elephantulus edwardii] Length = 184 Score = 131 bits (329), Expect = 2e-28 Identities = 62/84 (73%), Positives = 69/84 (82%) Frame = -2 Query: 383 CAQGNGQGHPQARWPKKSAEVLLDLLSNAQSNAEVKELNLDQLVIRHIQVNEAPKQRRRT 204 CAQ G Q RWPKKSAE LL +L NA+SNAE+K L++D LVI HIQVN+APK RRRT Sbjct: 70 CAQAKQWGWTQGRWPKKSAEFLLHMLKNAESNAELKGLDVDSLVIEHIQVNKAPKMRRRT 129 Query: 203 YRAHGRINPYMSSPCHIELFLTEK 132 YRAHGRINPYMSSPCHIE+ LTEK Sbjct: 130 YRAHGRINPYMSSPCHIEMILTEK 153 >ref|XP_006739155.1| PREDICTED: 60S ribosomal protein L17-like [Leptonychotes weddellii] Length = 184 Score = 131 bits (329), Expect = 2e-28 Identities = 62/84 (73%), Positives = 69/84 (82%) Frame = -2 Query: 383 CAQGNGQGHPQARWPKKSAEVLLDLLSNAQSNAEVKELNLDQLVIRHIQVNEAPKQRRRT 204 CAQ G Q RWPKKSAE LL +L NA+SNAE+K L++D LVI HIQVN+APK RRRT Sbjct: 70 CAQAKQWGWTQGRWPKKSAEFLLHMLKNAESNAELKGLDVDSLVIEHIQVNKAPKMRRRT 129 Query: 203 YRAHGRINPYMSSPCHIELFLTEK 132 YRAHGRINPYMSSPCHIE+ LTEK Sbjct: 130 YRAHGRINPYMSSPCHIEMILTEK 153 >ref|XP_006737075.1| PREDICTED: 60S ribosomal protein L17-like [Leptonychotes weddellii] Length = 184 Score = 131 bits (329), Expect = 2e-28 Identities = 62/84 (73%), Positives = 69/84 (82%) Frame = -2 Query: 383 CAQGNGQGHPQARWPKKSAEVLLDLLSNAQSNAEVKELNLDQLVIRHIQVNEAPKQRRRT 204 CAQ G Q RWPKKSAE LL +L NA+SNAE+K L++D LVI HIQVN+APK RRRT Sbjct: 70 CAQAKQWGWTQGRWPKKSAEFLLHMLKNAESNAELKGLDVDSLVIEHIQVNKAPKMRRRT 129 Query: 203 YRAHGRINPYMSSPCHIELFLTEK 132 YRAHGRINPYMSSPCHIE+ LTEK Sbjct: 130 YRAHGRINPYMSSPCHIEMILTEK 153 >dbj|BAC56547.1| similar to ribosomal protein L17 [Bos taurus] Length = 179 Score = 131 bits (329), Expect = 2e-28 Identities = 62/84 (73%), Positives = 69/84 (82%) Frame = -2 Query: 383 CAQGNGQGHPQARWPKKSAEVLLDLLSNAQSNAEVKELNLDQLVIRHIQVNEAPKQRRRT 204 CAQ G Q RWPKKSAE LL +L NA+SNAE+K L++D LVI HIQVN+APK RRRT Sbjct: 70 CAQAKQWGWTQGRWPKKSAEFLLHMLKNAESNAELKGLDVDSLVIEHIQVNKAPKMRRRT 129 Query: 203 YRAHGRINPYMSSPCHIELFLTEK 132 YRAHGRINPYMSSPCHIE+ LTEK Sbjct: 130 YRAHGRINPYMSSPCHIEMILTEK 153 >ref|NP_000976.1| 60S ribosomal protein L17 isoform a [Homo sapiens] gi|78000186|ref|NP_001030178.1| 60S ribosomal protein L17 isoform a [Homo sapiens] gi|192807307|ref|NP_001122314.1| 60S ribosomal protein L17 [Felis catus] gi|302148498|ref|NP_001180491.1| 60S ribosomal protein L17 [Macaca mulatta] gi|313569768|ref|NP_001186269.1| 60S ribosomal protein L17 isoform a [Homo sapiens] gi|313569770|ref|NP_001186270.1| 60S ribosomal protein L17 isoform a [Homo sapiens] gi|313569772|ref|NP_001186271.1| 60S ribosomal protein L17 isoform a [Homo sapiens] gi|313569774|ref|NP_001186272.1| 60S ribosomal protein L17 isoform a [Homo sapiens] gi|313569776|ref|NP_001186273.1| 60S ribosomal protein L17 isoform a [Homo sapiens] gi|756140958|ref|NP_001291839.1| ribosomal protein L17 [Ailuropoda melanoleuca] gi|109098059|ref|XP_001096059.1| PREDICTED: 60S ribosomal protein L17-like [Macaca mulatta] gi|114612611|ref|XP_001164527.1| PREDICTED: 60S ribosomal protein L17 [Pan troglodytes] gi|296217605|ref|XP_002755115.1| PREDICTED: 60S ribosomal protein L17 [Callithrix jacchus] gi|332236871|ref|XP_003267622.1| PREDICTED: 60S ribosomal protein L17 isoform X1 [Nomascus leucogenys] gi|332849879|ref|XP_003339352.1| PREDICTED: 60S ribosomal protein L17 [Pan troglodytes] gi|344269011|ref|XP_003406349.1| PREDICTED: 60S ribosomal protein L17 [Loxodonta africana] gi|390473965|ref|XP_003734701.1| PREDICTED: 60S ribosomal protein L17 [Callithrix jacchus] gi|426385930|ref|XP_004059449.1| PREDICTED: 60S ribosomal protein L17 isoform 1 [Gorilla gorilla gorilla] gi|426385932|ref|XP_004059450.1| PREDICTED: 60S ribosomal protein L17 isoform 2 [Gorilla gorilla gorilla] gi|426385934|ref|XP_004059451.1| PREDICTED: 60S ribosomal protein L17 isoform 3 [Gorilla gorilla gorilla] gi|426385936|ref|XP_004059452.1| PREDICTED: 60S ribosomal protein L17 isoform 4 [Gorilla gorilla gorilla] gi|426385938|ref|XP_004059453.1| PREDICTED: 60S ribosomal protein L17 isoform 5 [Gorilla gorilla gorilla] gi|426385940|ref|XP_004059454.1| PREDICTED: 60S ribosomal protein L17 isoform 6 [Gorilla gorilla gorilla] gi|426385942|ref|XP_004059455.1| PREDICTED: 60S ribosomal protein L17 isoform 7 [Gorilla gorilla gorilla] gi|441602851|ref|XP_004087761.1| PREDICTED: 60S ribosomal protein L17 isoform X1 [Nomascus leucogenys] gi|441602857|ref|XP_004087763.1| PREDICTED: 60S ribosomal protein L17 isoform X1 [Nomascus leucogenys] gi|471417010|ref|XP_004390024.1| PREDICTED: 60S ribosomal protein L17 isoform X1 [Trichechus manatus latirostris] gi|472382279|ref|XP_004410525.1| PREDICTED: 60S ribosomal protein L17 isoform X1 [Odobenus rosmarus divergens] gi|505845405|ref|XP_004616184.1| PREDICTED: 60S ribosomal protein L17 isoform X1 [Sorex araneus] gi|507932894|ref|XP_004677688.1| PREDICTED: 60S ribosomal protein L17 [Condylura cristata] gi|507951601|ref|XP_004683950.1| PREDICTED: 60S ribosomal protein L17 [Condylura cristata] gi|560903156|ref|XP_006177956.1| PREDICTED: 60S ribosomal protein L17 [Camelus ferus] gi|586454339|ref|XP_006837548.1| PREDICTED: 60S ribosomal protein L17 [Chrysochloris asiatica] gi|586530118|ref|XP_006919970.1| PREDICTED: 60S ribosomal protein L17 [Pteropus alecto] gi|591307879|ref|XP_007080600.1| PREDICTED: 60S ribosomal protein L17 isoform X1 [Panthera tigris altaica] gi|591307881|ref|XP_007080601.1| PREDICTED: 60S ribosomal protein L17 isoform X2 [Panthera tigris altaica] gi|617560528|ref|XP_007515986.1| PREDICTED: 60S ribosomal protein L17 isoform X1 [Erinaceus europaeus] gi|635098791|ref|XP_007972250.1| PREDICTED: 60S ribosomal protein L17 [Chlorocebus sabaeus] gi|640782322|ref|XP_008046798.1| PREDICTED: 60S ribosomal protein L17 [Tarsius syrichta] gi|667328365|ref|XP_008590525.1| PREDICTED: 60S ribosomal protein L17 [Galeopterus variegatus] gi|670978428|ref|XP_008690128.1| PREDICTED: 60S ribosomal protein L17 [Ursus maritimus] gi|675716903|ref|XP_008978011.1| PREDICTED: 60S ribosomal protein L17 [Callithrix jacchus] gi|675716906|ref|XP_008978012.1| PREDICTED: 60S ribosomal protein L17 [Callithrix jacchus] gi|675716910|ref|XP_008978013.1| PREDICTED: 60S ribosomal protein L17 [Callithrix jacchus] gi|675786684|ref|XP_008950805.1| PREDICTED: 60S ribosomal protein L17 [Pan paniscus] gi|675786686|ref|XP_008950806.1| PREDICTED: 60S ribosomal protein L17 [Pan paniscus] gi|675786688|ref|XP_008950807.1| PREDICTED: 60S ribosomal protein L17 [Pan paniscus] gi|675786690|ref|XP_008950808.1| PREDICTED: 60S ribosomal protein L17 [Pan paniscus] gi|685604014|ref|XP_009190971.1| PREDICTED: 60S ribosomal protein L17 [Papio anubis] gi|685604016|ref|XP_009190972.1| PREDICTED: 60S ribosomal protein L17 [Papio anubis] gi|685604018|ref|XP_009190973.1| PREDICTED: 60S ribosomal protein L17 [Papio anubis] gi|694918427|ref|XP_009450328.1| PREDICTED: 60S ribosomal protein L17 [Pan troglodytes] gi|694971336|ref|XP_009432251.1| PREDICTED: 60S ribosomal protein L17 [Pan troglodytes] gi|694971338|ref|XP_009432252.1| PREDICTED: 60S ribosomal protein L17 [Pan troglodytes] gi|694971340|ref|XP_009432253.1| PREDICTED: 60S ribosomal protein L17 [Pan troglodytes] gi|694971342|ref|XP_009432254.1| PREDICTED: 60S ribosomal protein L17 [Pan troglodytes] gi|694990359|ref|XP_009439390.1| PREDICTED: 60S ribosomal protein L17 [Pan troglodytes] gi|724808856|ref|XP_010358262.1| PREDICTED: 60S ribosomal protein L17 [Rhinopithecus roxellana] gi|724927138|ref|XP_010382288.1| PREDICTED: 60S ribosomal protein L17 [Rhinopithecus roxellana] gi|724961322|ref|XP_010354842.1| PREDICTED: 60S ribosomal protein L17 [Rhinopithecus roxellana] gi|724961324|ref|XP_010354843.1| PREDICTED: 60S ribosomal protein L17 [Rhinopithecus roxellana] gi|725563687|ref|XP_010335140.1| PREDICTED: 60S ribosomal protein L17 [Saimiri boliviensis boliviensis] gi|725563689|ref|XP_010335141.1| PREDICTED: 60S ribosomal protein L17 [Saimiri boliviensis boliviensis] gi|725563691|ref|XP_010335142.1| PREDICTED: 60S ribosomal protein L17 [Saimiri boliviensis boliviensis] gi|743731081|ref|XP_010959687.1| PREDICTED: 60S ribosomal protein L17 [Camelus bactrianus] gi|743731083|ref|XP_010959689.1| PREDICTED: 60S ribosomal protein L17 [Camelus bactrianus] gi|744594787|ref|XP_010988458.1| PREDICTED: 60S ribosomal protein L17 [Camelus dromedarius] gi|744594790|ref|XP_010988459.1| PREDICTED: 60S ribosomal protein L17 [Camelus dromedarius] gi|744594793|ref|XP_010988460.1| PREDICTED: 60S ribosomal protein L17 [Camelus dromedarius] gi|752431504|ref|XP_011233762.1| PREDICTED: 60S ribosomal protein L17 [Ailuropoda melanoleuca] gi|752431506|ref|XP_011233763.1| PREDICTED: 60S ribosomal protein L17 [Ailuropoda melanoleuca] gi|759095521|ref|XP_011359084.1| PREDICTED: 60S ribosomal protein L17 [Pteropus vampyrus] gi|795139672|ref|XP_011792337.1| PREDICTED: 60S ribosomal protein L17 [Colobus angolensis palliatus] gi|795314339|ref|XP_011824389.1| PREDICTED: 60S ribosomal protein L17 isoform X1 [Mandrillus leucophaeus] gi|795314349|ref|XP_011824391.1| PREDICTED: 60S ribosomal protein L17 isoform X1 [Mandrillus leucophaeus] gi|795314357|ref|XP_011824392.1| PREDICTED: 60S ribosomal protein L17 isoform X1 [Mandrillus leucophaeus] gi|795314366|ref|XP_011824393.1| PREDICTED: 60S ribosomal protein L17 isoform X1 [Mandrillus leucophaeus] gi|795314375|ref|XP_011824394.1| PREDICTED: 60S ribosomal protein L17 isoform X1 [Mandrillus leucophaeus] gi|795314383|ref|XP_011824395.1| PREDICTED: 60S ribosomal protein L17 isoform X1 [Mandrillus leucophaeus] gi|795314391|ref|XP_011824396.1| PREDICTED: 60S ribosomal protein L17 isoform X1 [Mandrillus leucophaeus] gi|795342194|ref|XP_011929990.1| PREDICTED: 60S ribosomal protein L17 isoform X2 [Cercocebus atys] gi|795342198|ref|XP_011929991.1| PREDICTED: 60S ribosomal protein L17 isoform X2 [Cercocebus atys] gi|795350250|ref|XP_011784191.1| PREDICTED: 60S ribosomal protein L17 isoform X1 [Colobus angolensis palliatus] gi|795350254|ref|XP_011784192.1| PREDICTED: 60S ribosomal protein L17 isoform X1 [Colobus angolensis palliatus] gi|795350260|ref|XP_011784193.1| PREDICTED: 60S ribosomal protein L17 isoform X1 [Colobus angolensis palliatus] gi|795350265|ref|XP_011784194.1| PREDICTED: 60S ribosomal protein L17 isoform X1 [Colobus angolensis palliatus] gi|795350270|ref|XP_011784195.1| PREDICTED: 60S ribosomal protein L17 isoform X1 [Colobus angolensis palliatus] gi|795350275|ref|XP_011784196.1| PREDICTED: 60S ribosomal protein L17 isoform X1 [Colobus angolensis palliatus] gi|795350284|ref|XP_011784197.1| PREDICTED: 60S ribosomal protein L17 isoform X1 [Colobus angolensis palliatus] gi|817341037|ref|XP_012296228.1| PREDICTED: 60S ribosomal protein L17 [Aotus nancymaae] gi|817341040|ref|XP_012296229.1| PREDICTED: 60S ribosomal protein L17 [Aotus nancymaae] gi|817341043|ref|XP_012296230.1| PREDICTED: 60S ribosomal protein L17 [Aotus nancymaae] gi|817341046|ref|XP_012296231.1| PREDICTED: 60S ribosomal protein L17 [Aotus nancymaae] gi|820980781|ref|XP_012361735.1| PREDICTED: 60S ribosomal protein L17 isoform X1 [Nomascus leucogenys] gi|820980785|ref|XP_012361736.1| PREDICTED: 60S ribosomal protein L17 isoform X1 [Nomascus leucogenys] gi|821116006|ref|XP_012381738.1| PREDICTED: 60S ribosomal protein L17 [Dasypus novemcinctus] gi|821116008|ref|XP_012381739.1| PREDICTED: 60S ribosomal protein L17 [Dasypus novemcinctus] gi|823426110|ref|XP_012421348.1| PREDICTED: 60S ribosomal protein L17 isoform X1 [Odobenus rosmarus divergens] gi|830036092|ref|XP_012581409.1| PREDICTED: 60S ribosomal protein L17 [Condylura cristata] gi|859791027|ref|XP_012911358.1| PREDICTED: 60S ribosomal protein L17 [Mustela putorius furo] gi|859791030|ref|XP_012911359.1| PREDICTED: 60S ribosomal protein L17 [Mustela putorius furo] gi|931603438|ref|XP_014197816.1| PREDICTED: 60S ribosomal protein L17 [Pan paniscus] gi|946618331|ref|XP_014408948.1| PREDICTED: 60S ribosomal protein L17 [Camelus ferus] gi|946618335|ref|XP_014408949.1| PREDICTED: 60S ribosomal protein L17 [Camelus ferus] gi|946618341|ref|XP_014408950.1| PREDICTED: 60S ribosomal protein L17 [Camelus ferus] gi|132799|sp|P18621.3|RL17_HUMAN RecName: Full=60S ribosomal protein L17; AltName: Full=60S ribosomal protein L23; AltName: Full=PD-1 gi|94730348|sp|Q5XTY7.3|RL17_FELCA RecName: Full=60S ribosomal protein L17 gi|187609317|pdb|2ZKR|RR Chain r, Structure Of A Mammalian Ribosomal 60s Subunit Within An 80s Complex Obtained By Docking Homology Models Of The Rna And Proteins Into An 8.7 A Cryo-em Map gi|485601437|pdb|3J3B|P Chain P, Structure Of The Human 60s Ribosomal Proteins gi|665764273|pdb|4CXD|P Chain P, Regulation Of The Mammalian Elongation Cycle By 40s Subunit Rolling: A Eukaryotic-specific Ribosome Rearrangement gi|672884390|pdb|4UPX|P Chain P, Mammalian 80s Hcv-ires Initiation Complex With Eif5b Pre-like State gi|672884442|pdb|4UQ1|P Chain P, Mammalian 80s Hcv-ires Initiation Complex With Eif5b Post-like State gi|34199|emb|CAA37793.1| unnamed protein product [Homo sapiens] gi|12653461|gb|AAH00502.1| Ribosomal protein L17 [Homo sapiens] gi|17389603|gb|AAH17831.1| Ribosomal protein L17 [Homo sapiens] gi|17932942|dbj|BAB79462.1| ribosomal protein L17 [Homo sapiens] gi|31324951|gb|AAH52940.1| Rpl17 protein [Mus musculus] gi|42542832|gb|AAH66323.1| Ribosomal protein L17 [Homo sapiens] gi|52840004|gb|AAU87901.1| ribosomal protein L17 [Felis catus] gi|77415453|gb|AAI06032.1| Ribosomal protein L17 [Homo sapiens] gi|119583344|gb|EAW62940.1| hCG24487, isoform CRA_c [Homo sapiens] gi|119583345|gb|EAW62941.1| hCG24487, isoform CRA_c [Homo sapiens] gi|119583346|gb|EAW62942.1| hCG24487, isoform CRA_c [Homo sapiens] gi|119583347|gb|EAW62943.1| hCG24487, isoform CRA_c [Homo sapiens] gi|119583348|gb|EAW62944.1| hCG24487, isoform CRA_c [Homo sapiens] gi|119583349|gb|EAW62945.1| hCG24487, isoform CRA_c [Homo sapiens] gi|123982774|gb|ABM83128.1| ribosomal protein L17 [synthetic construct] gi|123997445|gb|ABM86324.1| ribosomal protein L17 [synthetic construct] gi|189053148|dbj|BAG34770.1| unnamed protein product [Homo sapiens] gi|327239288|gb|AEA39511.1| ribosomal protein L17 [Ailuropoda melanoleuca] gi|327239390|gb|AEA39562.1| ribosomal protein L17 [Ailuropoda melanoleuca] gi|649152975|gb|AIC63153.1| RPL17, partial [synthetic construct] Length = 184 Score = 131 bits (329), Expect = 2e-28 Identities = 62/84 (73%), Positives = 69/84 (82%) Frame = -2 Query: 383 CAQGNGQGHPQARWPKKSAEVLLDLLSNAQSNAEVKELNLDQLVIRHIQVNEAPKQRRRT 204 CAQ G Q RWPKKSAE LL +L NA+SNAE+K L++D LVI HIQVN+APK RRRT Sbjct: 70 CAQAKQWGWTQGRWPKKSAEFLLHMLKNAESNAELKGLDVDSLVIEHIQVNKAPKMRRRT 129 Query: 203 YRAHGRINPYMSSPCHIELFLTEK 132 YRAHGRINPYMSSPCHIE+ LTEK Sbjct: 130 YRAHGRINPYMSSPCHIEMILTEK 153 >dbj|BAC56511.1| similar to ribosomal protein L17 [Bos taurus] Length = 143 Score = 131 bits (329), Expect = 2e-28 Identities = 62/84 (73%), Positives = 69/84 (82%) Frame = -2 Query: 383 CAQGNGQGHPQARWPKKSAEVLLDLLSNAQSNAEVKELNLDQLVIRHIQVNEAPKQRRRT 204 CAQ G Q RWPKKSAE LL +L NA+SNAE+K L++D LVI HIQVN+APK RRRT Sbjct: 48 CAQAKQWGWTQGRWPKKSAEFLLHMLKNAESNAELKGLDVDSLVIEHIQVNKAPKMRRRT 107 Query: 203 YRAHGRINPYMSSPCHIELFLTEK 132 YRAHGRINPYMSSPCHIE+ LTEK Sbjct: 108 YRAHGRINPYMSSPCHIEMILTEK 131 >ref|XP_012914337.1| PREDICTED: 60S ribosomal protein L17-like isoform X2 [Mustela putorius furo] Length = 184 Score = 131 bits (329), Expect = 2e-28 Identities = 62/84 (73%), Positives = 69/84 (82%) Frame = -2 Query: 383 CAQGNGQGHPQARWPKKSAEVLLDLLSNAQSNAEVKELNLDQLVIRHIQVNEAPKQRRRT 204 CAQ G Q RWPKKSAE LL +L NA+SNAE+K L++D LVI HIQVN+APK RRRT Sbjct: 70 CAQAKQWGWTQGRWPKKSAEFLLHMLKNAESNAELKGLDVDSLVIEHIQVNKAPKMRRRT 129 Query: 203 YRAHGRINPYMSSPCHIELFLTEK 132 YRAHGRINPYMSSPCHIE+ LTEK Sbjct: 130 YRAHGRINPYMSSPCHIEMILTEK 153 >ref|XP_012914336.1| PREDICTED: 60S ribosomal protein L17-like isoform X1 [Mustela putorius furo] Length = 198 Score = 131 bits (329), Expect = 2e-28 Identities = 62/84 (73%), Positives = 69/84 (82%) Frame = -2 Query: 383 CAQGNGQGHPQARWPKKSAEVLLDLLSNAQSNAEVKELNLDQLVIRHIQVNEAPKQRRRT 204 CAQ G Q RWPKKSAE LL +L NA+SNAE+K L++D LVI HIQVN+APK RRRT Sbjct: 70 CAQAKQWGWTQGRWPKKSAEFLLHMLKNAESNAELKGLDVDSLVIEHIQVNKAPKMRRRT 129 Query: 203 YRAHGRINPYMSSPCHIELFLTEK 132 YRAHGRINPYMSSPCHIE+ LTEK Sbjct: 130 YRAHGRINPYMSSPCHIEMILTEK 153 >ref|XP_012874450.1| PREDICTED: LOW QUALITY PROTEIN: 60S ribosomal protein L17-like [Dipodomys ordii] Length = 184 Score = 131 bits (329), Expect = 2e-28 Identities = 62/84 (73%), Positives = 69/84 (82%) Frame = -2 Query: 383 CAQGNGQGHPQARWPKKSAEVLLDLLSNAQSNAEVKELNLDQLVIRHIQVNEAPKQRRRT 204 CAQ G Q RWPKKSAE LL +L NA+SNAE+K L++D LVI HIQVN+APK RRRT Sbjct: 70 CAQAKQWGWTQGRWPKKSAEFLLHMLKNAESNAELKGLDVDSLVIEHIQVNKAPKMRRRT 129 Query: 203 YRAHGRINPYMSSPCHIELFLTEK 132 YRAHGRINPYMSSPCHIE+ LTEK Sbjct: 130 YRAHGRINPYMSSPCHIEMILTEK 153 >ref|XP_004703038.2| PREDICTED: 60S ribosomal protein L17 [Echinops telfairi] Length = 184 Score = 131 bits (329), Expect = 2e-28 Identities = 62/84 (73%), Positives = 69/84 (82%) Frame = -2 Query: 383 CAQGNGQGHPQARWPKKSAEVLLDLLSNAQSNAEVKELNLDQLVIRHIQVNEAPKQRRRT 204 CAQ G Q RWPKKSAE LL +L NA+SNAE+K L++D LVI HIQVN+APK RRRT Sbjct: 70 CAQAKQWGWTQGRWPKKSAEFLLHMLKNAESNAELKGLDVDSLVIEHIQVNKAPKMRRRT 129 Query: 203 YRAHGRINPYMSSPCHIELFLTEK 132 YRAHGRINPYMSSPCHIE+ LTEK Sbjct: 130 YRAHGRINPYMSSPCHIEMILTEK 153 >ref|XP_012786948.1| PREDICTED: 60S ribosomal protein L17 isoform X2 [Ochotona princeps] Length = 174 Score = 131 bits (329), Expect = 2e-28 Identities = 62/84 (73%), Positives = 69/84 (82%) Frame = -2 Query: 383 CAQGNGQGHPQARWPKKSAEVLLDLLSNAQSNAEVKELNLDQLVIRHIQVNEAPKQRRRT 204 CAQ G Q RWPKKSAE LL +L NA+SNAE+K L++D LVI HIQVN+APK RRRT Sbjct: 70 CAQAKQWGWTQGRWPKKSAEFLLHMLKNAESNAELKGLDVDSLVIEHIQVNKAPKMRRRT 129 Query: 203 YRAHGRINPYMSSPCHIELFLTEK 132 YRAHGRINPYMSSPCHIE+ LTEK Sbjct: 130 YRAHGRINPYMSSPCHIEMILTEK 153 >ref|XP_012625355.1| PREDICTED: 60S ribosomal protein L17 [Microcebus murinus] Length = 201 Score = 131 bits (329), Expect = 2e-28 Identities = 62/84 (73%), Positives = 69/84 (82%) Frame = -2 Query: 383 CAQGNGQGHPQARWPKKSAEVLLDLLSNAQSNAEVKELNLDQLVIRHIQVNEAPKQRRRT 204 CAQ G Q RWPKKSAE LL +L NA+SNAE+K L++D LVI HIQVN+APK RRRT Sbjct: 70 CAQAKQWGWTQGRWPKKSAEFLLHMLKNAESNAELKGLDVDSLVIEHIQVNKAPKMRRRT 129 Query: 203 YRAHGRINPYMSSPCHIELFLTEK 132 YRAHGRINPYMSSPCHIE+ LTEK Sbjct: 130 YRAHGRINPYMSSPCHIEMILTEK 153 >ref|XP_012498116.1| PREDICTED: 60S ribosomal protein L17 [Propithecus coquereli] Length = 171 Score = 131 bits (329), Expect = 2e-28 Identities = 62/84 (73%), Positives = 69/84 (82%) Frame = -2 Query: 383 CAQGNGQGHPQARWPKKSAEVLLDLLSNAQSNAEVKELNLDQLVIRHIQVNEAPKQRRRT 204 CAQ G Q RWPKKSAE LL +L NA+SNAE+K L++D LVI HIQVN+APK RRRT Sbjct: 70 CAQAKQWGWTQGRWPKKSAEFLLHMLKNAESNAELKGLDVDSLVIEHIQVNKAPKMRRRT 129 Query: 203 YRAHGRINPYMSSPCHIELFLTEK 132 YRAHGRINPYMSSPCHIE+ LTEK Sbjct: 130 YRAHGRINPYMSSPCHIEMILTEK 153