BLASTX nr result
ID: Cornus23_contig00039649
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00039649 (271 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006361552.1| PREDICTED: U-box domain-containing protein 4... 58 3e-06 ref|XP_004239199.1| PREDICTED: U-box domain-containing protein 4... 58 3e-06 ref|XP_010250775.1| PREDICTED: U-box domain-containing protein 4... 57 4e-06 gb|EPS72148.1| hypothetical protein M569_02603 [Genlisea aurea] 57 7e-06 >ref|XP_006361552.1| PREDICTED: U-box domain-containing protein 45-like [Solanum tuberosum] Length = 772 Score = 57.8 bits (138), Expect = 3e-06 Identities = 27/34 (79%), Positives = 33/34 (97%) Frame = -3 Query: 104 NNIVLKFEKARSALEDSLRQVEDIVPQAIGCQIS 3 ++IVLKFE+AR ALEDSL++VEDIVPQ+IGCQIS Sbjct: 87 DSIVLKFERARCALEDSLKRVEDIVPQSIGCQIS 120 >ref|XP_004239199.1| PREDICTED: U-box domain-containing protein 45-like [Solanum lycopersicum] gi|723699255|ref|XP_010320999.1| PREDICTED: U-box domain-containing protein 45-like [Solanum lycopersicum] Length = 770 Score = 57.8 bits (138), Expect = 3e-06 Identities = 27/34 (79%), Positives = 33/34 (97%) Frame = -3 Query: 104 NNIVLKFEKARSALEDSLRQVEDIVPQAIGCQIS 3 ++IVLKFE+AR ALEDSL++VEDIVPQ+IGCQIS Sbjct: 87 DSIVLKFERARCALEDSLKRVEDIVPQSIGCQIS 120 >ref|XP_010250775.1| PREDICTED: U-box domain-containing protein 45-like [Nelumbo nucifera] Length = 767 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/34 (76%), Positives = 33/34 (97%) Frame = -3 Query: 104 NNIVLKFEKARSALEDSLRQVEDIVPQAIGCQIS 3 +++++KFEKAR +LEDSLR+VEDIVPQAIGCQIS Sbjct: 84 DSVLVKFEKARCSLEDSLRRVEDIVPQAIGCQIS 117 >gb|EPS72148.1| hypothetical protein M569_02603 [Genlisea aurea] Length = 792 Score = 56.6 bits (135), Expect = 7e-06 Identities = 29/52 (55%), Positives = 40/52 (76%) Frame = -3 Query: 158 ILDHIVINVWIYTS*LKRNNIVLKFEKARSALEDSLRQVEDIVPQAIGCQIS 3 +L H V +Y + + +++VLKFEKAR ALEDSL++VEDIVP+ IGCQI+ Sbjct: 67 VLQHCVECSKLYLA-ITGDSVVLKFEKARFALEDSLKRVEDIVPETIGCQIA 117