BLASTX nr result
ID: Cornus23_contig00039356
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00039356 (260 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHJ30795.1| putative wd domain containing protein [Erysiphe n... 73 9e-11 >gb|KHJ30795.1| putative wd domain containing protein [Erysiphe necator] Length = 687 Score = 72.8 bits (177), Expect = 9e-11 Identities = 33/48 (68%), Positives = 38/48 (79%) Frame = -3 Query: 144 MDELIDFALDAQRVFSAQRNRSQSDMVSIMSCCWSQDGKILYTATEEG 1 MDELIDFALDAQRV + QR Q+ +V+ M CCWSQDGKI+Y ATE G Sbjct: 620 MDELIDFALDAQRVITGQRISPQNGIVTTMGCCWSQDGKIIYAATESG 667